DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and Ant2

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster

Alignment Length:397 Identity:71/398 (18%)
Similarity:141/398 (35%) Gaps:102/398 (26%)


  Fly    33 GGGGGGGTGGSGGSGGTSGGNNLKPERSAREDDAINRLTDSKSSHRKLLSDPRFQIRPLQQVISA 97
            |||||.|.|                              |.||.              |...:..
  Fly     5 GGGGGHGKG------------------------------DLKSF--------------LMDFMMG 25

  Fly    98 CTGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSW 162
            ...|.|....:.|::.:|..:|.|:.                       |:..:..||  :....
  Fly    26 GVSAAIAKTAVAPIERVKLILQVQEV-----------------------SKQIAADQR--YKGIV 65

  Fly   163 DALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRD 227
            |..::|.:.:|.::.|.|....::...|:..:.|...:.:|:.:|...:.|   .|..||.    
  Fly    66 DCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKH---KQFWRHF---- 123

  Fly   228 TKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ-----RQTYAQMLQFVRSVVALQGVWG 287
                   ...:.||..|...::..|.|::..||::.|.     .:.:..::..:..|:...|..|
  Fly   124 -------AGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIG 181

  Fly   288 LWRGLRPTILRDVPFSGIYWPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVKTH 352
            |:||...::...|.:...|:..|::.:..|.:.....|.:|:....:..|||.|.:.|||.|:..
  Fly   182 LYRGFIVSVQGIVIYRAAYFGFYDTCRDFLPNPKSTPFYVSWAIAQVVTTVAGIASYPFDTVRRR 246

  Fly   353 EQIEFG---ERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTF 414
            ..::.|   ..:::          |:|......|.:..|:...|.|....::: ....|::::.:
  Fly   247 MMMQSGLKKSEMVY----------KNTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALY 300

  Fly   415 EYSKSFF 421
            :..|.:|
  Fly   301 DEMKKYF 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 18/121 (15%)
Mito_carr 230..321 CDD:278578 18/96 (19%)
Mito_carr 321..425 CDD:278578 20/105 (19%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 62/354 (18%)
Mito_carr 17..111 CDD:278578 20/133 (15%)
Mito_carr 119..215 CDD:278578 20/107 (19%)
Mito_carr 218..307 CDD:278578 19/100 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1997693
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.