DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2616 and SPBP23A10.06

Sequence 1:NP_001287212.1 Gene:CG2616 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_595818.1 Gene:SPBP23A10.06 PomBaseID:SPBP23A10.06 Length:335 Species:Schizosaccharomyces pombe

Alignment Length:384 Identity:115/385 (30%)
Similarity:188/385 (49%) Gaps:87/385 (23%)


  Fly    67 INRLTDSKSSHRKLLSDPRFQIRPLQQVISACTGAMITACFMTPLDVIKTRMQSQQ-------SP 124
            |...|:...:...:.::|  .::|:.:::|||.|::||...:|||||:|||:||:.       .|
pombe     3 IGAATEGVEADLSVNAEP--DVKPIAKMLSACVGSVITTLTVTPLDVVKTRLQSESISQYSSTQP 65

  Fly   125 AHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKISRHEGLAALWSGLGPTLVSAL 189
            .........|..    |..|.|..::.|.|             |:||||:.:||.||.|:|...|
pombe    66 ISSAKILGKGRP----APKPLGGPVSGLYQ-------------IARHEGVRSLWRGLVPSLTMLL 113

  Fly   190 PSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSLPSVVPMMSGVTARICAVTVVSP 254
            |:..:.|:.|||.    |.:|...                 ..|:.. .::|.:||..:.|:|||
pombe   114 PANTVQFLGYEQL----LPLYSDW-----------------GFPAAA-AIAGASARTISATIVSP 156

  Fly   255 IELVRTKMQA---------QRQTYAQMLQFVRSVVALQGVWGLWRGLRPTILRDVPFSGIYWPIY 310
            |||.||::||         .|:...::...::.::..:|:..||.|:..|:.||||||..||..|
pombe   157 IELFRTRVQAVGGHYPPGHAREIANEVFDGLKLMIHQKGILNLWSGVSVTLWRDVPFSAFYWWSY 221

  Fly   311 ESLKQ-NLGHGSQPSFS---------LSFLAGVMAGTVAAIVTTPFDVVKTHEQIEFGERVIFTD 365
            |.::. .|||.|..:||         ::|::|.::||:|.::|.||||.||.:|:.         
pombe   222 ERIRLFLLGHPSLQAFSSSQSTKDLYINFVSGGISGTLATLLTQPFDVSKTAKQVH--------- 277

  Fly   366 SPARDFGKKSTFSR---LTGIYRTHGVRGLFAGCGPRLLKVAPACAIMISTFEYSKSFF 421
                    ..|.:|   :..:::..|.:.|:.|..||.:||||:||||||::..:|.:|
pombe   278 --------GHTLTRGQFMLTLWKRGGPKALWKGTLPRCVKVAPSCAIMISSYHLTKKYF 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 41/128 (32%)
Mito_carr 230..321 CDD:278578 34/101 (34%)
Mito_carr 321..425 CDD:278578 35/114 (31%)
SPBP23A10.06NP_595818.1 Mito_carr 21..132 CDD:278578 43/132 (33%)
Mito_carr 148..231 CDD:278578 29/83 (35%)
Mito_carr 242..331 CDD:278578 32/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6040
Inparanoid 1 1.050 163 1.000 Inparanoid score I1207
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001348
OrthoInspector 1 1.000 T631597
orthoMCL 1 0.900 OOG5_127938
Panther 1 1.100 LDO PTHR45760
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2199
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.