DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaTub84D and TUBA1C

DIOPT Version :10

Sequence 1:NP_524264.1 Gene:alphaTub84D / 40904 FlyBaseID:FBgn0003885 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001290043.1 Gene:TUBA1C / 84790 HGNCID:20768 Length:519 Species:Homo sapiens


Alignment Length:41 Identity:11/41 - (26%)
Similarity:16/41 - (39%) Gaps:6/41 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PEACSIVTF----IGDGLRFRIIDIKALAFLYY--YPNDRD 69
            ||:..:..|    .....||.:.|.:..:.|.|  ..||.|
Human    25 PESSGVARFGPLHFDRRARFEVTDEEKQSRLRYQNLENDED 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaTub84DNP_524264.1 PTZ00335 1..439 CDD:185562 11/41 (27%)
TUBA1CNP_001290043.1 PTZ00335 72..518 CDD:185562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.