DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Est10 and F55F3.2

Sequence 1:NP_001246962.1 Gene:alpha-Est10 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_741921.1 Gene:F55F3.2 WormBaseID:WBGene00010116 Length:548 Species:Caenorhabditis elegans

Alignment Length:575 Identity:148/576 (26%)
Similarity:252/576 (44%) Gaps:97/576 (17%)


  Fly    43 LSTAIYSV-IKTKSG--PVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFKAPEAVEPWDQELDC 104
            |:...|.| ::|.:|  .:||::..  :|   .||..|.:|:||||..||.|...::|... ::.
 Worm    18 LADPTYDVTVQTPNGSATIRGIQHT--YG---TSFRGIRYAQPPVGLFRFGAARRLDPVGL-VEA 76

  Fly   105 TSPADKPLQ-----THMFFRKYAGSEDCLYLNVYVKD--LQPDKLRPVMVWIYGGGYQV--GEAS 160
            .:..:..:|     :|         ||||::|||..:  .|..|| ||.|:|:|||:..  |...
 Worm    77 QAYGNICVQGDGRTSH---------EDCLFINVYTPNNVTQASKL-PVYVYIHGGGFVEGGGNMG 131

  Fly   161 RDMYSPDFFMSKDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGDS 225
            ..:| |:......:|:|::.||||..||.|  ..|:..|||..:.|.|.||.|||:.|..||||.
 Worm   132 AGIY-PNLVNKGPIVMVSINYRLGPFGFFS--TRQMTAPGNWAISDWIEALNWVQRYISFFGGDP 193

  Fly   226 NNITLFGESAGGASTHFLALSPQTEGLIHKAIVMSGS----VLCPWTQPPRNNWAYRLAQKLG-Y 285
            |.:|:.|:|:|..:...|.|:|..:.|..::|..|||    .:..:::..|:. :.:|:.||| .
 Worm   194 NRVTIGGQSSGAEAVSTLTLTPLAKNLFKQSIHESGSAFGAAVMSYSEKTRST-SKQLSIKLGCA 257

  Fly   286 TGDNKDK-----AIFEFLRSMSGGEIVKATATVLSNDEKHHRILFAFGPVVE--PYTT---EHTV 340
            |.|..|.     .|...||:::..:||.|     .|....||:.::   :|:  .|.|   |:..
 Worm   258 TSDQWDNGQSFGTILTCLRNVTYDKIVAA-----DNSLPGHRMKWS---IVQDNKYLTQRLEYLA 314

  Fly   341 VAKQPHELMQNSWSHRIPMMFGGTSFEGLLFYPEVSRRPATLDEVGNCKNLLPSDLGLNLDPKLR 405
            :.:.|.:          .::.|....|.|.:  |::.....::...|..:.:..||..:.:....
 Worm   315 LQRDPKK----------NVLIGDVHDEWLGW--EMNNVLHNINSSHNTAHQMRDDLSGSYEMTYW 367

  Fly   406 ENYGLQLKKA---YFGDEPCNQANMMKF----LELCSYREFWHPIYR-AALNRVRQSSAPTYLYR 462
            :|....|..|   |..::.....|..::    ::|.|...|..|..| ||..:..:::  .|||.
 Worm   368 DNKQSVLVAADNKYINNQGWTDDNHREWEARRIQLWSEMVFIGPTLRDAAYFQYMKNN--VYLYS 430

  Fly   463 FDHDSKLCNAIRIVLCGHQMRGVCHGDDLCYIFHSMLSHQSAPDSPEHKVITG-MVDVWTSFAAH 526
            .|..|.  .|:.:| .....||..|..:|.|||.:  |......:.:.:::.. ....|.:|...
 Worm   431 LDWLSP--PALPLV-TDPLFRGCEHTWELQYIFST--SCNGFTCTAQDEILRNYFTTTWLNFIIG 490

  Fly   527 GDPNCESIKSLKFAPIENVTNFKCLNIGDQFEVMALPELQKIEPVWNSFYAPNKL 581
            |:|          .|..:...||.|.:......::.....|::|    .|.|:.:
 Worm   491 GNP----------TPAGSPLPFKWLAMDSTNRFLSFSPNPKMQP----HYHPDSM 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 139/529 (26%)
Aes <132..>279 CDD:223730 54/155 (35%)
F55F3.2NP_741921.1 Abhydrolase 22..510 CDD:304388 143/545 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.