DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Est10 and T22D1.11

Sequence 1:NP_001246962.1 Gene:alpha-Est10 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_501070.1 Gene:T22D1.11 WormBaseID:WBGene00020688 Length:583 Species:Caenorhabditis elegans

Alignment Length:563 Identity:145/564 (26%)
Similarity:223/564 (40%) Gaps:131/564 (23%)


  Fly    26 NGDFIQQVISFKYEQRKLSTAIYSVIKTKSGPVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFK 90
            |.|.:..|:...|...|...|  .||.|..|.:.|   |.|  |||.:|:||||||||:|.|||:
 Worm     3 NFDMLIFVLLIVYSAYKSCEA--GVITTSLGSING---NQI--GSYQTFKKIPFAKPPIGKLRFQ 60

  Fly    91 APEAVEPWDQELDCT---------SPADKPLQTHMFFRKYAGSEDCLYLNVYVKD-LQPDKLRPV 145
            .|.|.|.|:..|:.|         |...|..|..:       .||||::|::..| ....|...|
 Worm    61 KPMAAEKWEGILNATEYGPACMSNSSTSKSPQKWI-------DEDCLHINIFTTDTCLSSKNCSV 118

  Fly   146 MVWIYGGG--YQVGEASRDMYSPDFFMSKDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQI 208
            :.:::||.  |.......|.|..|.|.|:||::|..|:|||......::|..: .|.|..|.|.:
 Worm   119 VFYVHGGELVYDSAVMFEDKYLFDTFSSRDVILVIPAFRLGLFSHFVVEDQNV-APNNLALYDIL 182

  Fly   209 MALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALSPQ--TEGLIHKAIVMSGSVLCPWTQPP 271
            :||.:|:..|..|||.|:.:|.||.|.||.....:|.|.:  |:....:.::...||        
 Worm   183 LALEFVKSEIHNFGGSSDRVTAFGHSYGGHVVSVMAFSTEINTDLSYFQRVICMSSV-------- 239

  Fly   272 RNNW---------AYRLAQ----------KLGYTGDNKDKAIFEFLRSMSGGEIVKATATVLSND 317
             |.|         ..|..|          |...|...:|..:.|.|:.:...|:::...::  .|
 Worm   240 -NVWDSLEFEIEKTMRFIQYANCSVPQDLKSRMTSFEQDSYMMECLQDIDSMELLRIQRSL--ED 301

  Fly   318 EKH--HRILFAFGPVVEPYTTEHTVVAKQPHELMQNSWSHRIPMMFGGTSFEGLLFYPEVSRRPA 380
            |.|  :..|....|:::      .|:.:..:|..:|     ||.:.|.|       |.|      
 Worm   302 EGHPIYSGLVLREPLIQ------NVLVQDFYEKPKN-----IPTLTGCT-------YKE------ 342

  Fly   381 TLDEVGNCKNLLPSDLGLNLDPKLRENYGLQLKKAYFGDEPCNQANMMKFLELCSYREFWHPIYR 445
             ||:.....|::.: ||.       ||| .:....|..|....:.::.|..:     |.:..:.:
 Worm   343 -LDKFHAYHNIVET-LGY-------ENY-KECDDKYRDDRKYGRFDLNKHAD-----ETFGILAQ 392

  Fly   446 AALNRVRQ--SSAPTYLYRFD---HDSKLCNAIRIVLCGHQMRGVCHGDDLCYIFHSMLSHQSAP 505
            ..|...:|  ...|||.|.:.   |.|                   |.|||.||   |..|....
 Worm   393 TKLKVDKQLDKGIPTYFYEYSYPKHPS-------------------HTDDLSYI---MGVHAFEK 435

  Fly   506 DSPEHKVITGMVDVWTSFAAHGDPNCESIKSLKFAPIENVTNF 548
            |..|..:.....:::.:|...|:|.    ...:.:..||.:.|
 Worm   436 DENEIHLAKSYQEMFMNFVKFGEPG----GGFEMSTFENSSYF 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 136/533 (26%)
Aes <132..>279 CDD:223730 45/161 (28%)
T22D1.11NP_501070.1 Abhydrolase 20..500 CDD:304388 140/547 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C90893241
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.