| Sequence 1: | NP_001246962.1 | Gene: | alpha-Est10 / 40896 | FlyBaseID: | FBgn0015569 | Length: | 581 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_501070.1 | Gene: | cest-6 / 177459 | WormBaseID: | WBGene00020688 | Length: | 583 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 563 | Identity: | 145/563 - (25%) | 
|---|---|---|---|
| Similarity: | 223/563 - (39%) | Gaps: | 131/563 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    26 NGDFIQQVISFKYEQRKLSTAIYSVIKTKSGPVRGVKRNTIWGGSYFSFEKIPFAKPPVGDLRFK 90 
  Fly    91 APEAVEPWDQELDCT---------SPADKPLQTHMFFRKYAGSEDCLYLNVYVKD-LQPDKLRPV 145 
  Fly   146 MVWIYGGG--YQVGEASRDMYSPDFFMSKDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQI 208 
  Fly   209 MALRWVQQNIEAFGGDSNNITLFGESAGGASTHFLALSPQ--TEGLIHKAIVMSGSVLCPWTQPP 271 
  Fly   272 RNNW---------AYRLAQ----------KLGYTGDNKDKAIFEFLRSMSGGEIVKATATVLSND 317 
  Fly   318 EKH--HRILFAFGPVVEPYTTEHTVVAKQPHELMQNSWSHRIPMMFGGTSFEGLLFYPEVSRRPA 380 
  Fly   381 TLDEVGNCKNLLPSDLGLNLDPKLRENYGLQLKKAYFGDEPCNQANMMKFLELCSYREFWHPIYR 445 
  Fly   446 AALNRVRQ--SSAPTYLYRFD---HDSKLCNAIRIVLCGHQMRGVCHGDDLCYIFHSMLSHQSAP 505 
  Fly   506 DSPEHKVITGMVDVWTSFAAHGDPNCESIKSLKFAPIENVTNF 548 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| alpha-Est10 | NP_001246962.1 | COesterase | 49..542 | CDD:278561 | 136/532 (26%) | 
| Aes | <132..>279 | CDD:223730 | 44/160 (28%) | ||
| cest-6 | NP_501070.1 | Abhydrolase | 25..500 | CDD:389770 | 139/539 (26%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160156950 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1516 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.740 | |||||