DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: alpha-Est10 and ace-4

Sequence 1:NP_001246962.1 Gene:alpha-Est10 FlyBaseID:FBgn0015569 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_496962.1 Gene:ace-4 WormBaseID:WBGene00000038 Length:602 Species:Caenorhabditis elegans

Alignment Length:586 Identity:158/587 (27%)
Similarity:236/587 (40%) Gaps:126/587 (21%)


  Fly    50 VIKTKSGPVRGV-------KRNTIWGGSYFSFEKIPFAKPPVGDLRFKAPEAVEPWDQELDCTSP 107
            |::||.|.::|.       |..|.:|        :|||:|.|.|.||:.|...:.|....|.|.|
 Worm    28 VLETKLGDIKGTEFFFLSKKIRTFFG--------VPFAEPAVEDFRFRKPREKKQWRGLYDATKP 84

  Fly   108 ADKPLQT-----------HMFFRKYAGSEDCLYLNVYVKDLQPDKLR-PVMVWIYGGGYQVGEAS 160
            |:...||           .|:......||||||||::.   ..|... .||||.:|||:..|..|
 Worm    85 ANACFQTRDNYNTSFWGSEMWNANTQISEDCLYLNIWA---PADAYNLTVMVWFFGGGFYSGSPS 146

  Fly   161 RDMYSPDFFMS-KDVVIVTVAYRLGALGFLSLDDPQLNVPGNAGLKDQIMALRWVQQNIEAFGGD 224
            ..:|......| ::|::|.:.||||..|||.|..|  :.|||.||.||.:||.||:|||.:|||:
 Worm   147 LSIYDGKALTSTQNVIVVNINYRLGPFGFLYLGHP--DAPGNMGLLDQQLALHWVRQNIVSFGGN 209

  Fly   225 SNNITLFGESAGGASTHFLALSPQTEGLIHKAIVMSGSVLCPWTQPPRNNWA----YRLAQK--- 282
            .:.:.:||:|||.||.....::|.:.||...||:.|||:        .|.||    :|..||   
 Worm   210 PDKVAVFGQSAGAASIVAHLIAPGSRGLFKNAILQSGSL--------ENTWAINSPFRAKQKSEK 266

  Fly   283 -LGYTGDNK---DKAIFEFLRSMSGGEIVKAT----------ATVLSNDEKHHRILFAFGPVVEP 333
             |...|.||   |.:: ..||.:|..::..:|          ..|:.:.:||.     ||     
 Worm   267 LLELVGCNKTTVDTSM-ACLRLVSPEQLSLSTWNISLTYLEFPFVIVSRDKHF-----FG----- 320

  Fly   334 YTTEHTVVAKQPHELMQNSWSHRIPMMFGGTSFEGLLFYPEVSRRPATLDEVGNCKNLLPSDLG- 397
            :...|..       |.:..::..:.:|.|....||  .|..:.:.|...|:..      |.:|. 
 Worm   321 HLDAHAA-------LREGDFNRDVNLMIGMNKDEG--NYWNIYQLPQFFDKAD------PPELNR 370

  Fly   398 LNLDPKLRENYGLQ------LKKAYFGDEPC-----------NQANMMKFLELCSYREFWHPIYR 445
            ...|..:...:.:|      ..|..:.|..|           .|.|.:......|....|.....
 Worm   371 TEFDFLIDRTFSIQPDIIRSAAKYIYSDPNCTDHGRKTRFYAGQMNQIVGDYFFSCDSLWLADQF 435

  Fly   446 AALNRVRQSS-----APTYLYRFDHDSKLCNAIRIVLCGHQMRGVCHGDDLCYIFHSMLSHQSAP 505
            .::.||:.||     ...::|.|...|. .|.      ..:..|..||.::.|:|...||:....
 Worm   436 RSIPRVKSSSPQRKPGKVFVYHFTQSSS-ANP------WPKWTGAMHGYEIEYVFGIPLSYSKNY 493

  Fly   506 DSPEHKVITGMVDVWTSFAAHGDPNCESIKSLKFAPIENVTNFKCLNIGDQFEVMALPELQKIEP 570
            ...|......::..|.|||.:|.|....:|:.:..|..|..|        .:..|.|.....|.|
 Worm   494 KRREQIFSRKIMQFWASFAKNGTPKLRVLKNSEHWPEFNEQN--------HYRWMQLRSGSNIRP 550

  Fly   571 V 571
            :
 Worm   551 I 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
alpha-Est10NP_001246962.1 COesterase 49..542 CDD:278561 152/556 (27%)
Aes <132..>279 CDD:223730 59/153 (39%)
ace-4NP_496962.1 COesterase 28..562 CDD:278561 158/587 (27%)
Aes <120..>243 CDD:223730 52/128 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92563947
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.