DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and ARK1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_014378.1 Gene:ARK1 / 855711 SGDID:S000004965 Length:638 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:86/292 - (29%)
Similarity:147/292 - (50%) Gaps:17/292 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNINGSRYTIRERLATGGF-----SLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKI 82
            |.:...:..|.:.|.:|||     :||:..:..|......:||:........|....|::..|.:
Yeast    15 LTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIVPDKPSLNTLRAEVDAMRLL 79

  Fly    83 DSENVIRVVDYELKGQADIVI-NTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLG 146
              :|...||.|.....|..:: |.:..:|:::.|.:.|.|.|.  :.:|.|:.:.|.:||||...
Yeast    80 --KNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF--MNTRLQNRLHEFEILQIMSQ 140

  Fly   147 VCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEER 211
            |.:|:.|:|...| ||.|||:|..|:.:|.:.|..:.|.||:...........:...:|.:..:.
Yeast   141 VTQGVAAMHALQP-PLIHRDIKIENVLISANNEYKLCDFGSVCGIIRPPRNSQELSYVQQDILKN 204

  Fly   212 SSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPE 276
            ::..||:||:........|||::|||:||..||.:||:.:|::   :.||   ||:|||....|.
Yeast   205 TTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLCYYTTPFE---KGGD---LAILSGKFEFPL 263

  Fly   277 DSIYTEDMHELIKYMLRTDPMERPFVFSVIER 308
            ...|:|.:..||:.:|..||..||.|:.:::|
Yeast   264 YPNYSEQLKGLIRDILVQDPRHRPNVYQLLKR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 85/286 (30%)
S_TKc 30..300 CDD:214567 81/275 (29%)
ARK1NP_014378.1 STKc_NAK_like 18..301 CDD:270939 85/289 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.