DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and MYLK2

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_149109.1 Gene:MYLK2 / 85366 HGNCID:16243 Length:596 Species:Homo sapiens


Alignment Length:318 Identity:70/318 - (22%)
Similarity:136/318 - (42%) Gaps:54/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TLNINGSRYTIRERLATGG--FSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDS 84
            |.|:: |.:::..:.|.||  |..:......:|....|.|.|...:..|:.:.|.|||...:::.
Human   276 TGNVS-SEFSMNSKEALGGGKFGAVCTCMEKATGLKLAAKVIKKQTPKDKEMVLLEIEVMNQLNH 339

  Fly    85 ENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQD-HMPEAQILQIFLGVC 148
            .|:|         |....|.|...:.:.:.|.:.|.|.:    |...:| |:.|...:.....:|
Human   340 RNLI---------QLYAAIETPHEIVLFMEYIEGGELFE----RIVDEDYHLTEVDTMVFVRQIC 391

  Fly   149 EGLKAIHEAMPVPLAHRDLKTANI-CLSDSFEPI-IVDLGSMTEARLQIVGQTDAQRLQDEAEER 211
            :|:..:|:   :.:.|.|||..|| |::.:...: |:|.|.             |:|.  ...|:
Human   392 DGILFMHK---MRVLHLDLKPENILCVNTTGHLVKIIDFGL-------------ARRY--NPNEK 438

  Fly   212 SSIVYRAPELFT--VKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVAL-AVLSGNIN 273
            ..:.:..||..:  |..|..|.::||:||:|.:.|.:.   |...|.....|:..| .|||||..
Human   439 LKVNFGTPEFLSPEVVNYDQISDKTDMWSMGVITYMLL---SGLSPFLGDDDTETLNNVLSGNWY 500

  Fly   274 IPEDSI--YTEDMHELIKYMLRTDPMER---------PFVFSVIERTHDLIQKLEGRL 320
            ..|::.  .:::..:.:..::..|...|         |::.::.|:.....::|:.::
Human   501 FDEETFEAVSDEAKDFVSNLIVKDQRARMNAAQCLAHPWLNNLAEKAKRCNRRLKSQI 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 66/303 (22%)
S_TKc 30..300 CDD:214567 64/288 (22%)
MYLK2NP_149109.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..224
STKc_MLCK2 280..540 CDD:271092 66/294 (22%)
Calmodulin-binding. /evidence=ECO:0000250 574..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.