DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and AUR2

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001325078.1 Gene:AUR2 / 817129 AraportID:AT2G25880 Length:349 Species:Arabidopsis thaliana


Alignment Length:291 Identity:59/291 - (20%)
Similarity:101/291 - (34%) Gaps:52/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI---ALREIENCRKIDSENVIR 89
            |.:.|.:.|..|.|..:.|.....:....|:|.:....:....:   ..||:|....:...|::|
plant    84 SDFDIGKPLGRGKFGHVYLAREKRSDHIVALKVLFKAQLQQSQVEHQLRREVEIQSHLRHPNILR 148

  Fly    90 VVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAI 154
            :..|         ......::::|.|...|.|...||    |..:..|.:.......:...|...
plant   149 LYGY---------FYDQKRVYLILEYAVRGELYKELQ----KCKYFSERRAATYVASLARALIYC 200

  Fly   155 HEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEA---RLQIVGQTDAQRLQDEAEERSSIVY 216
            |....:   |||:|..|:.:....|..|.|.|.....   |..:.|..|               |
plant   201 HGKHVI---HRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLD---------------Y 247

  Fly   217 RAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVALAVLSGNINIPE 276
            ..||:.....:   |...||||||.:.|...|...|::     ..|:|       ::..::..|.
plant   248 LPPEMVESVEH---DASVDIWSLGILCYEFLYGVPPFEAREHSETYKR-------IVQVDLKFPP 302

  Fly   277 DSIYTEDMHELIKYMLRTDPMERPFVFSVIE 307
            ..|.:....:||..||..:..:|..:..::|
plant   303 KPIVSSSAKDLISQMLVKESTQRLALHKLLE 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 58/290 (20%)
S_TKc 30..300 CDD:214567 56/280 (20%)
AUR2NP_001325078.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.