DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Gm7358

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_978062.3 Gene:Gm7358 / 664831 MGIID:3643256 Length:549 Species:Mus musculus


Alignment Length:280 Identity:64/280 - (22%)
Similarity:124/280 - (44%) Gaps:33/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVIRVVD 92
            |:|.:...|..|.::.:.|.::..|....|:|.:..:....|. |::|....:||...|::.::.
Mouse    67 SQYKVVRTLGHGTYAKVLLAQHRLTGTPVAVKVLLKNKPCFQP-AMKEANIMKKIKHPNIVSLLQ 130

  Fly    93 YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEA 157
                     ||.|.:..::::...:...|.:::    :...|:.|.:..||||.:...:...|.:
Mouse   131 ---------VIETKTRGYLIMELVEGQELYEYI----KNSGHIEEDEARQIFLQILSAVGYCHGS 182

  Fly   158 MPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELF 222
               .:.|||||..||.:.......|:|.|..|:.:       ..|.|.   |...:..:.|||||
Mouse   183 ---GIVHRDLKPDNIMIDSKGSIKIIDFGLSTQVK-------PGQLLH---EHCGAYAFGAPELF 234

  Fly   223 TVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDSIYTEDMHEL 287
            ..|:|  ...::|:|:||.:||.|.....|:|....  ..:.:.:|:|  ..|.....:.::.:|
Mouse   235 LWKSY--DGTKSDLWALGVILYYMVVGKVPFDSFII--PELQMQILAG--VYPAPCGVSNELKDL 293

  Fly   288 IKYMLRTDPMERPFVFSVIE 307
            :..::..:|..||.|..|::
Mouse   294 LSLLMTVNPKYRPTVTEVMK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 63/279 (23%)
S_TKc 30..300 CDD:214567 59/269 (22%)
Gm7358XP_978062.3 STKc_AMPK-like 68..316 CDD:270905 63/279 (23%)
UBA_MARK_Par1 336..375 CDD:270522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.