DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and MARK4

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001186796.1 Gene:MARK4 / 57787 HGNCID:13538 Length:752 Species:Homo sapiens


Alignment Length:296 Identity:76/296 - (25%)
Similarity:123/296 - (41%) Gaps:48/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALR 74
            |..:.||.:|..::  ..|.:...:..|.|:.:.|..:..|.|..|||.|....::..::  ..|
Human    43 RNSIASCPEEQPHV--GNYRLLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFR 105

  Fly    75 EIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQ 139
            |:...:.::..|::::.:         ||.|..||::|:.|...|.:.|:|....|.::....|:
Human   106 EVRIMKGLNHPNIVKLFE---------VIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAK 161

  Fly   140 ILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRL 204
            ..||       :.|:|......:.|||||..|:.|.......|.|.|...|..|       ..:|
Human   162 FRQI-------VSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTL-------GSKL 212

  Fly   205 QDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVA 264
            ....   .|..|.|||||..|.|  .....||||||.:||.:...:.|:|     .:.||     
Human   213 DTFC---GSPPYAAPELFQGKKY--DGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRER----- 267

  Fly   265 LAVLSGNINIPEDSIY-TEDMHELIKYMLRTDPMER 299
              ||.|...:|   .| :.|...:::..|..:|.:|
Human   268 --VLRGKYRVP---FYMSTDCESILRRFLVLNPAKR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 72/279 (26%)
S_TKc 30..300 CDD:214567 72/278 (26%)
MARK4NP_001186796.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
STKc_MARK 58..310 CDD:270974 72/279 (26%)
S_TKc 59..310 CDD:214567 72/278 (26%)
UBA_MARK3_4 328..370 CDD:270590
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..614
MARK4_C 654..752 CDD:213382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.