DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and mark4b

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_005157655.1 Gene:mark4b / 571279 ZFINID:ZDB-GENE-100330-2 Length:796 Species:Danio rerio


Alignment Length:296 Identity:76/296 - (25%)
Similarity:122/296 - (41%) Gaps:48/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RGCLFSCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALR 74
            |..:.||..|..:|  ..|.:.:.:..|.|:.:.|..:..|.|..|||.|....::..::  ..|
Zfish    42 RNSIASCSDEQPHI--GNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFR 104

  Fly    75 EIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQ 139
            |:...:.::..|::::.:         ||.|..||::|:.|...|.:.|:|....|.::.....:
Zfish   105 EVRIMKGLNHPNIVQLFE---------VIETEKTLYLVMEYASGGEVFDYLVSHGRMKEKEARGK 160

  Fly   140 ILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRL 204
            ..||       :.|:|......:.|||||..|:.|.......|.|.|...|..|       ..:|
Zfish   161 FRQI-------VSAVHYCHLKNIVHRDLKAENLLLDADSNIKIADFGFSNEFTL-------GSKL 211

  Fly   205 QDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVA 264
            ....   .|..|.|||||..|.|  .....||||||.:||.:...:.|:|     .:.||     
Zfish   212 DTFC---GSPPYAAPELFQGKKY--DGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRER----- 266

  Fly   265 LAVLSGNINIPEDSIY-TEDMHELIKYMLRTDPMER 299
              ||.|...:|   .| :.|...:::..|..:|.:|
Zfish   267 --VLRGKYRVP---FYMSTDCEGILRRFLVLNPTKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 71/279 (25%)
S_TKc 30..300 CDD:214567 71/278 (26%)
mark4bXP_005157655.1 STKc_MARK 57..309 CDD:270974 71/279 (25%)
S_TKc 58..309 CDD:214567 71/278 (26%)
UBA_like_SF 327..369 CDD:304366
MARK4_C 699..796 CDD:213382
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.