DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and pak6b

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001155959.1 Gene:pak6b / 567874 ZFINID:ZDB-GENE-041014-121 Length:607 Species:Danio rerio


Alignment Length:302 Identity:60/302 - (19%)
Similarity:113/302 - (37%) Gaps:66/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVIRVVDYELKGQA 99
            ::..|...::.:.....:.|..|:|.:.......:.:...|:...|....:||:.:....|.|: 
Zfish   338 KIGEGSTGVVCIAREKHSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYRHQNVVEMYKSALVGE- 401

  Fly   100 DIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAH 164
                    .|::::.|.:.|:|.:.:     .:..:.|.||..:...|.:.|..:|..   .:.|
Zfish   402 --------ELWVIMEYLQGGALTNIV-----SETRLTEEQIATVCESVLQALCYLHSQ---GVIH 450

  Fly   165 RDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSI---VYRAPELFTVKT 226
            ||:|:.:|.|:......:.|.|..            ||..:|..:.||.:   .:.|||:.:...
Zfish   451 RDIKSDSILLTLDGRVKLSDFGFC------------AQISKDVPKRRSLVGTPYWMAPEVVSKTP 503

  Fly   227 YCTIDERTDIWSLGCVLYAMCYFNSPY---------------DPIYERGDSVALAVLSGNINIPE 276
            |.|   ..||||||.::..|.....||               .|...|..|....||...:    
Zfish   504 YGT---EVDIWSLGIMVVEMVDGEPPYFSETPISAMKRLRDEPPPTARNASKISPVLRDFL---- 561

  Fly   277 DSIYTEDMHELIKYMLRTDPMERPFVFS---------VIERT 309
            ||:.|.:..:...   .:|.::.||:..         ::|:|
Zfish   562 DSMLTREPQQRSS---ASDLLQHPFLLQCSSPRCLIPLVEQT 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 60/302 (20%)
S_TKc 30..300 CDD:214567 56/282 (20%)
pak6bNP_001155959.1 PBD 13..65 CDD:279166
STKc_PAK6 311..607 CDD:270821 60/302 (20%)
S_TKc 338..584 CDD:214567 57/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.