| Sequence 1: | NP_001287207.1 | Gene: | CG1227 / 40872 | FlyBaseID: | FBgn0037491 | Length: | 320 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005161235.2 | Gene: | phkg1b / 554046 | ZFINID: | ZDB-GENE-050522-52 | Length: | 450 | Species: | Danio rerio |
| Alignment Length: | 330 | Identity: | 89/330 - (26%) |
|---|---|---|---|
| Similarity: | 136/330 - (41%) | Gaps: | 86/330 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 29 RYTIRERLATGGFSLIDLGENASTRRSYAIK--------RITCHSIDD-QNIALREIENCRKIDS 84
Fly 85 E-NVIRVVD-YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLR---SRKQDHMPEAQILQIF 144
Fly 145 LGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAE 209
Fly 210 ERSSIVYRAPELFTVKTYCTIDER-------TDIWSLGCVLYAMCYFNSPYDPIYERGDSVAL-A 266
Fly 267 VLSG--NINIPEDSIYTEDMHELIKYMLRTDPMER---------PFV----------------FS 304
Fly 305 VIERT 309 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1227 | NP_001287207.1 | STKc_16 | 29..314 | CDD:270888 | 89/330 (27%) |
| S_TKc | 30..300 | CDD:214567 | 82/302 (27%) | ||
| phkg1b | XP_005161235.2 | PKc_like | 16..291 | CDD:304357 | 84/308 (27%) |
| Pkinase | 20..288 | CDD:278497 | 83/304 (27%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||