DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and melk

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001016390.1 Gene:melk / 549144 XenbaseID:XB-GENE-987654 Length:652 Species:Xenopus tropicalis


Alignment Length:278 Identity:74/278 - (26%)
Similarity:120/278 - (43%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSI-DDQNIALREIENCRKIDSENVIRVVDY 93
            |.:.|.:.||||:.:.|..:.:|....|||.:...|: ||......||:..:.:..::|.|:.. 
 Frog    13 YELHETIGTGGFAKVKLASHLTTGEKVAIKIMDKESLGDDLPRVKTEIDAMKNLSHQHVCRLYH- 76

  Fly    94 ELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAM 158
                    ||.|.:.:|:||.|...|.|.|::..:    |.:.|.:....|..:...:..||.. 
 Frog    77 --------VIETPNKIFMVLEYCPGGELFDYIIAK----DRLTEDEARVFFRQIVSAVAYIHSQ- 128

  Fly   159 PVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELFT 223
              ..||||||..|:.:.:.....::|.|...:.:    |..|...:..    ..|..|.||||..
 Frog   129 --GYAHRDLKPENLLIDEDQNLKLIDFGLCAKPK----GGLDYHLMTC----CGSPAYAAPELIQ 183

  Fly   224 VKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVAL---AVLSGNINIPE----DSIYT 281
            .|.|  |....||||:|.::||:.....|:|     .|:|.:   .::.|...||:    .|:. 
 Frog   184 GKAY--IGSEADIWSMGVLMYALMCGYLPFD-----DDNVMVLYKKIMRGKYEIPKWLSPGSVL- 240

  Fly   282 EDMHELIKYMLRTDPMER 299
                 |:..||:.||.:|
 Frog   241 -----LLSQMLQVDPKKR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 74/278 (27%)
S_TKc 30..300 CDD:214567 74/278 (27%)
melkNP_001016390.1 STKc_MELK 9..265 CDD:270980 74/278 (27%)
UBA_MELK 284..334 CDD:270526
UBA-like. /evidence=ECO:0000250 284..323
Autoinhibitory region. /evidence=ECO:0000250 328..652
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..492
MELK_C 556..650 CDD:213383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.