DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Aak1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_017448306.1 Gene:Aak1 / 500244 RGDID:1305520 Length:1306 Species:Rattus norvegicus


Alignment Length:297 Identity:95/297 - (31%)
Similarity:157/297 - (52%) Gaps:26/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 INGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDS-ENVI 88
            |...:.|:.|.||.|||:|:.| ...|.....|:||:..::..|..:..|||:..|.:.. :|::
  Rat    41 IGRQQVTVDEVLAEGGFALVFL-VRTSNGVKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIV 104

  Fly    89 RVVDYELKGQADIVINTTST-----LFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVC 148
                    |..|..||..|:     :.|::.:.:.|.:.:  .:..|.|....|.::||||...|
  Rat   105 --------GYIDSSINNVSSGDVWEVLILMDFCRGGQVVN--LMNQRLQTGFTENEVLQIFCDTC 159

  Fly   149 EGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSS 213
            |.:..:|:. ..|:.|||||..||.|.|....::.|.||.|. :.|.........::||.::.::
  Rat   160 EAVARLHQC-KTPIIHRDLKVENILLHDRGHYVLCDFGSATN-KFQNPQAEGVNAVEDEIKKYTT 222

  Fly   214 IVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDS 278
            :.|||||:..:.:...|..:.|||:|||:||.:|||..|:      |:| .:|:..|:..||::|
  Rat   223 LSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPF------GES-QVAICDGSFTIPDNS 280

  Fly   279 IYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQK 315
            .|::|||.||:|||..||.:||.::.|...:..|::|
  Rat   281 RYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 93/290 (32%)
S_TKc 30..300 CDD:214567 89/275 (32%)
Aak1XP_017448306.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.