DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and NEK3

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_002489.1 Gene:NEK3 / 4752 HGNCID:7746 Length:506 Species:Homo sapiens


Alignment Length:294 Identity:77/294 - (26%)
Similarity:132/294 - (44%) Gaps:42/294 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITC-HSIDDQNIALREIENCRKIDSENVIRVVD- 92
            |.:...:..|.|....|.::.|:.:.:|:|.|.. .|..:...:.:|.....|:...|::...: 
Human     4 YMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKES 68

  Fly    93 YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEA 157
            :|.:|.          |:||:.|...|.|..  :::.:|....||..||..|..:|.|:..||:.
Human    69 FEAEGH----------LYIVMEYCDGGDLMQ--KIKQQKGKLFPEDMILNWFTQMCLGVNHIHKK 121

  Fly   158 MPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIV----YRA 218
            .   :.|||:|:.||.|:.:.:   |.||....|||          |.:......:.|    |..
Human   122 R---VLHRDIKSKNIFLTQNGK---VKLGDFGSARL----------LSNPMAFACTYVGTPYYVP 170

  Fly   219 PELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDSIYTED 283
            ||::....|   :.::|||||||:||.:|....|:..  ....::.|.|..|.|: |..|.|:.:
Human   171 PEIWENLPY---NNKSDIWSLGCILYELCTLKHPFQA--NSWKNLILKVCQGCIS-PLPSHYSYE 229

  Fly   284 MHELIKYMLRTDPMERPFVFSVIER--THDLIQK 315
            :..|:|.|.:.:|..||...:::.|  ...|:||
Human   230 LQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 75/291 (26%)
S_TKc 30..300 CDD:214567 71/275 (26%)
NEK3NP_002489.1 Interaction with VAV2. /evidence=ECO:0000269|PubMed:15618286 1..285 77/294 (26%)
STKc_Nek3 3..257 CDD:173759 74/286 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..325
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..490
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.