DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and NEK1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001186326.1 Gene:NEK1 / 4750 HGNCID:7744 Length:1286 Species:Homo sapiens


Alignment Length:290 Identity:76/290 - (26%)
Similarity:136/290 - (46%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RYTIRERLATGGFSLIDLGENASTRRSYAIKRITCH--SIDDQNIALREIENCRKIDSENVIRVV 91
            :|...:::..|.|....|.::....|.|.||.|...  |..::..:.||:.....:...|:::..
Human     3 KYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYR 67

  Fly    92 D-YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIH 155
            : :|..|          :|:||:.|.:.|.|  ..::.::|.....|.|||..|:.:|..||.:|
Human    68 ESFEENG----------SLYIVMDYCEGGDL--FKRINAQKGVLFQEDQILDWFVQICLALKHVH 120

  Fly   156 EAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIV----Y 216
            :.   .:.|||:|:.||.|:   :...|.||....||:          |....|...:.:    |
Human   121 DR---KILHRDIKSQNIFLT---KDGTVQLGDFGIARV----------LNSTVELARTCIGTPYY 169

  Fly   217 RAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGD--SVALAVLSGNINIPEDSI 279
            .:||:...|.|   :.::|||:||||||.:|....    .:|.|.  ::.|.::||  :.|..|:
Human   170 LSPEICENKPY---NNKSDIWALGCVLYELCTLKH----AFEAGSMKNLVLKIISG--SFPPVSL 225

  Fly   280 -YTEDMHELIKYMLRTDPMERPFVFSVIER 308
             |:.|:..|:..:.:.:|.:||.|.|::|:
Human   226 HYSYDLRSLVSQLFKRNPRDRPSVNSILEK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 76/290 (26%)
S_TKc 30..300 CDD:214567 71/279 (25%)
NEK1NP_001186326.1 STKc_Nek1 3..258 CDD:270858 76/290 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.