DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and aurA

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_476749.1 Gene:aurA / 41446 FlyBaseID:FBgn0000147 Length:411 Species:Drosophila melanogaster


Alignment Length:293 Identity:66/293 - (22%)
Similarity:118/293 - (40%) Gaps:57/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI---ALREIENCRK 81
            |:|..:|  .:.|...|..|.|..:.|.....::...|:|.:....|.:.|:   ..||||....
  Fly   146 KKTWELN--NFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSH 208

  Fly    82 IDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQ-DHMPEAQILQIFL 145
            :...:::|:..|         .:....::::|.|...|:|.:.||.:..|: |....|..:|   
  Fly   209 LRHPHILRLYAY---------FHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQ--- 261

  Fly   146 GVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLG-SMTE---ARLQIVGQTDAQRLQD 206
            .:|..|..:||.   .:.|||:|..|:.|.......|.|.| |:.|   .|:.:.|..|      
  Fly   262 ALCSALLYLHER---DIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVD------ 317

  Fly   207 EAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMC-----YFNSPYDPIYERGDSVALA 266
                     |..||:...|.:   .:..|:||||.:.:.:.     :::..||..|::       
  Fly   318 ---------YLPPEMVQGKPH---TKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKK------- 363

  Fly   267 VLSGNINIPEDSIYTEDMHELIKYMLRTDPMER 299
            :|..:..:||.  .::....||..:|..:|..|
  Fly   364 ILKVDYKLPEH--ISKAASHLISKLLVLNPQHR 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 63/284 (22%)
S_TKc 30..300 CDD:214567 63/283 (22%)
aurANP_476749.1 STKc_Aurora 153..407 CDD:270909 63/284 (22%)
S_TKc 154..406 CDD:214567 63/283 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.