DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and KP78b

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001163587.1 Gene:KP78b / 41361 FlyBaseID:FBgn0026063 Length:604 Species:Drosophila melanogaster


Alignment Length:319 Identity:85/319 - (26%)
Similarity:135/319 - (42%) Gaps:57/319 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QSIGWTLIMKRGCLFSCR-------KETLNING-SRYTIRERLATGGFSLIDLGENASTRRSYAI 58
            |::|       ||..|..       :..:|.|| ..|.|.:.|..|.|:.:.|..:..|.|..||
  Fly    34 QNVG-------GCFGSSGGRSSPKFQSYVNGNGYGVYKIIKTLGKGNFAKVKLAIHLPTGREVAI 91

  Fly    59 KRI---TCHSIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGS 120
            |.|   ..::|..|.: .||:...:|::..|::|::.         ||.:..||::|:.|...|.
  Fly    92 KLIDKTALNTIARQKL-YREVNIMKKLNHPNIVRLLQ---------VIESERTLYLVMEYVSGGE 146

  Fly   121 LADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDL 185
            |.::|....|.::.  :|::|  |..:...::..|..   .:.|||||..|:.|....:..|.|.
  Fly   147 LFNYLVKNGRMRER--DARVL--FRQLVSAIEYCHSK---SIVHRDLKAENLLLDQQMKLKIADF 204

  Fly   186 GSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFN 250
            |..|....:...:|..          .|..|.|||||..|.|.  ....|.||||.|||.:...:
  Fly   205 GFSTTFEPKAPLETFC----------GSPPYAAPELFRGKKYS--GPEVDSWSLGVVLYTLVSGS 257

  Fly   251 SPYD--PIYERGDSVALAVLSGNINIPEDSIYTE-DMHELIKYMLRTDPMERPFVFSVI 306
            .|:|  .:.|..|    .||.|...:|   .|.. :...||:..|..:|.:|..:.:|:
  Fly   258 LPFDGTNLKELRD----RVLRGKYRVP---YYVSIECESLIRKFLVLNPTQRTSLSAVM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 77/284 (27%)
S_TKc 30..300 CDD:214567 75/275 (27%)
KP78bNP_001163587.1 PKc_like 63..314 CDD:304357 77/283 (27%)
S_TKc 63..314 CDD:214567 77/283 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.