DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Nek7

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_038946825.1 Gene:Nek7 / 360850 RGDID:1311160 Length:340 Species:Rattus norvegicus


Alignment Length:329 Identity:80/329 - (24%)
Similarity:137/329 - (41%) Gaps:88/329 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IMKRGCLFSCRKETLNINGSRYTIRERL-------ATGGFSLIDLGENASTRRSYAIKRITCHSI 66
            |::.|....|.::.:..:....:.||.|       :.|.|.|:|           |..|..|   
  Rat    67 ILRWGHPHVCSQDAVTSSSLSTSWREDLTIAKGAGSQGIFDLMD-----------AKARADC--- 117

  Fly    67 DDQNIALREIENCRKIDSENVIR-----VVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQ 126
                  ::||:..::::..|||:     :.|.||.              |||.....|.|:..::
  Rat   118 ------IKEIDLLKQLNHPNVIKYYASFIEDNELN--------------IVLELADAGDLSRMIK 162

  Fly   127 LRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLG----- 186
            ...:::..:||..:.:.|:.:|..|..:|...   :.|||:|.||:.::.:....:.|||     
  Rat   163 HFKKQKRLIPERTVWKYFVQLCSALDHMHSRR---VMHRDIKPANVFITATGVVKLGDLGLGRFF 224

  Fly   187 -SMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFN 250
             |.|.|...:||               :..|.:||......|   :.::|||||||:||.|....
  Rat   225 SSKTTAAHSLVG---------------TPYYMSPERIHENGY---NFKSDIWSLGCLLYEMAALQ 271

  Fly   251 SPYDPIYERGDSVALAVLSGNIN------IPEDSIYTEDMHELIKYMLRTDPMERP---FVFSVI 306
            ||:     .||.:.|..|...|.      :|.|. |:|::.:|:...:..||.:||   :|:.|.
  Rat   272 SPF-----YGDKMNLYSLCKKIEQCDYPPLPSDH-YSEELRQLVNICINPDPEKRPDIAYVYDVA 330

  Fly   307 ERTH 310
            :|.|
  Rat   331 KRMH 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 77/309 (25%)
S_TKc 30..300 CDD:214567 71/293 (24%)
Nek7XP_038946825.1 STKc_Nek6_7 33..332 CDD:270863 78/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.