DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and ark1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001018849.1 Gene:ark1 / 3361036 PomBaseID:SPCC320.13c Length:355 Species:Schizosaccharomyces pombe


Alignment Length:303 Identity:69/303 - (22%)
Similarity:116/303 - (38%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITCH-------SIDDQNIALREIENCRKIDSENV 87
            :.|.:.|..|.|..:.|.:...|....|:|  |.|       .|:.|  ..||||....:..:|:
pombe    89 FEIGKPLGKGKFGRVYLAKEKKTGFIVALK--TLHKSELVQSKIEKQ--VRREIEIQSNLRHKNI 149

  Fly    88 IRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLK 152
            :|:..:         .:....::::|.:...|.|..||:...|..:.:....|.|    :...|.
pombe   150 LRLYGH---------FHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIFQ----MANALS 201

  Fly   153 AIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEA----RLQIVGQTDAQRLQDEAEERSS 213
            .:|:...:   |||:|..||.|....|..:.|.|....|    |..:.|..|             
pombe   202 YLHKKHVI---HRDIKPENILLGIDGEIKLSDFGWSVHAPSNRRTTLCGTLD------------- 250

  Fly   214 IVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPI------YERGDSVALAVLSGNI 272
              |..||:...|.:   .|:.|:||||.:.|.......|::.:      |:|       :...::
pombe   251 --YLPPEMVEGKEH---TEKVDLWSLGVLTYEFLVGAPPFEDMSGHSATYKR-------IAKVDL 303

  Fly   273 NIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQK 315
            .||  |....|..:||..:|:.:|.:|..:..|:.  |..|.|
pombe   304 KIP--SFVPPDARDLISRLLQHNPEKRMSLEQVMR--HPWIVK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 67/300 (22%)
S_TKc 30..300 CDD:214567 64/286 (22%)
ark1NP_001018849.1 STKc_Aurora 89..341 CDD:270909 67/300 (22%)
S_TKc 89..340 CDD:214567 67/299 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.