DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Ttk

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006243522.1 Gene:Ttk / 315852 RGDID:1305558 Length:864 Species:Rattus norvegicus


Alignment Length:319 Identity:82/319 - (25%)
Similarity:144/319 - (45%) Gaps:49/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SCRKETLNINGSRYTIRERLATGGFSLI--DLGENASTRRSYAIKRITCHSIDDQNI--ALREIE 77
            |...|.:::||..|:|.:::.:||.|.:  .|.|.   ::..|||.:.....|.|.|  ...||.
  Rat   519 SSMSECISVNGRIYSILKQIGSGGSSKVFQVLNEK---KQINAIKYVNLEDADSQTIDSYRNEIA 580

  Fly    78 NCRKID--SENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQI 140
            ...|:.  |:.:||:.|||:         |...:::|:   :.|::..:..|:.:|..:..|.: 
  Rat   581 YLNKLQQHSDKIIRLYDYEI---------TDRYIYMVM---ECGNIDLNSWLKKKKSINPWERK- 632

  Fly   141 LQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQ 205
             ..:..:.|.:..||:.   .:.|.|||.||..:.|....:| |.|...:.      |.|...:.
  Rat   633 -SYWKNMLEAVHTIHQH---GIVHSDLKPANFLIVDGMLKLI-DFGIANQM------QPDTTSIV 686

  Fly   206 DEAEERSSIVYRAPELF----------TVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERG 260
            .:::. .::.|.|||..          .:||  .|..|:|:|||||:||.|.|..:|:..|..:.
  Rat   687 KDSQV-GTVNYMAPEAIRDMSSSRENGKIKT--KISPRSDVWSLGCILYYMTYGKTPFQHIINQV 748

  Fly   261 DSV-ALAVLSGNINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVIERTHDLIQKLEG 318
            ..: |:...|..|..||  |..:|:.:::|..|..:|.||..:..::...:..||...|
  Rat   749 SKLHAIIDPSHEIEFPE--ISEKDLRDVLKCCLVRNPKERISIPELLAHPYVQIQPHPG 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 75/301 (25%)
S_TKc 30..300 CDD:214567 74/286 (26%)
TtkXP_006243522.1 PKc_Mps1 530..798 CDD:271033 75/299 (25%)
Pkinase 532..798 CDD:278497 75/297 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.