DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Nek4

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001013152.2 Gene:Nek4 / 306252 RGDID:1304995 Length:793 Species:Rattus norvegicus


Alignment Length:278 Identity:67/278 - (24%)
Similarity:139/278 - (50%) Gaps:38/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GGFSLIDLGENASTRRSYAIKRITCH--SIDDQNIALREIENCRKIDSENVIRVVDYELKGQADI 101
            |.:..:.|.::....:.|.||::...  |..::..|.:|.:...::...|::...:....|.   
  Rat    15 GSYGEVTLVKHRRDGKQYVIKKLNLRNASSRERRAAEQEAQLLSQLKHPNIVTYKESWEGGD--- 76

  Fly   102 VINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRD 166
                 ..|:||:.:.:.|.|  :.:|:.:|...:||:|:::.|:.:...|:.:||.   .:.|||
  Rat    77 -----GLLYIVMGFCEGGDL--YRKLKEQKGQLLPESQVVEWFVQIAMALQYLHEK---HILHRD 131

  Fly   167 LKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIV----YRAPELFTVKTY 227
            |||.|:.|:   ...|:.:|.:..||:          |::.::..|:::    |.:||||:.|.|
  Rat   132 LKTQNVFLT---RTNIIKVGDLGIARV----------LENHSDMASTLIGTPYYMSPELFSNKPY 183

  Fly   228 CTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDSIYTEDMHELIKYML 292
               :.::|:|:|||.:|.|......::.  :..:|:...::.|.:. |...:|:.::.|||:.||
  Rat   184 ---NYKSDVWALGCCVYEMATLKHAFNA--KDMNSLVYRIIEGKLP-PMPKVYSAELAELIRTML 242

  Fly   293 RTDPMERPFVFSVIERTH 310
            ...|.|||.|.|::.:.:
  Rat   243 SRRPEERPSVRSILRQPY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 67/278 (24%)
S_TKc 30..300 CDD:214567 63/266 (24%)
Nek4NP_001013152.2 STKc_Nek4 5..261 CDD:270862 67/278 (24%)
S_TKc 6..261 CDD:214567 67/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.