DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and Aurka

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_695208.2 Gene:Aurka / 261730 RGDID:628895 Length:397 Species:Rattus norvegicus


Alignment Length:292 Identity:62/292 - (21%)
Similarity:107/292 - (36%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIK---RITCHSIDDQNIALREIENCRKIDSENVIRVV 91
            :.|...|..|.|..:.|.....::...|:|   ::.......::...||:|....:...|::|:.
  Rat   126 FDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSHLRHPNILRLY 190

  Fly    92 DYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQI--FLGVCEGLKAI 154
            .|         .:..:.::::|.|...|::...||..|:..:......|.::  .|..|...:.|
  Rat   191 GY---------FHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVI 246

  Fly   155 HEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEA----RLQIVGQTDAQRLQDEAEERSSIV 215
                     |||:|..|:.|..:.|..|.|.|....|    |..:.|..|               
  Rat   247 ---------HRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLD--------------- 287

  Fly   216 YRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSP-----YDPIYERGDSVALAVLSGNINIP 275
            |..||:...:.:   ||:.|:||||.:.|.......|     |...|.|...|       ....|
  Rat   288 YLPPEMIEGRMH---DEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRV-------EFTFP 342

  Fly   276 EDSIYTEDMHELIKYMLRTDPMERPFVFSVIE 307
            :  ..||...:||..:|:.:..:|..:..|:|
  Rat   343 D--FVTEGARDLISRLLKHNSSQRLTLAEVLE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 62/292 (21%)
S_TKc 30..300 CDD:214567 59/283 (21%)
AurkaNP_695208.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118
STKc_Aurora-A 120..376 CDD:271018 62/292 (21%)
Activation segment. /evidence=ECO:0000250|UniProtKB:O14965 273..286 3/12 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.