DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and ppk29

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001342923.1 Gene:ppk29 / 2541080 PomBaseID:SPBC557.04 Length:872 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:86/297 - (28%)
Similarity:156/297 - (52%) Gaps:32/297 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GSRY-------TIRERLATGGFSLIDLGE-NASTRRS---YAIKRITCHSIDDQNIALR----EI 76
            ||::       ||.:.:|.||||.:.|.: |:.|..|   ..:||:  :|.|:.  |||    ||
pombe    15 GSKFVIGKYNVTIEKYIAEGGFSHVYLVQTNSKTDGSPITAVLKRM--YSPDEN--ALRFVKTEI 75

  Fly    77 ENCRKIDSE-NVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQI 140
            |....:.|. :|:..:|..:.......:||...:.:::.|...|.|.|.  :..|.|..:.|.::
pombe    76 ETMELLKSNPHVVSYIDSCIFPLEKAGVNTGFEILLLMEYCAGGGLIDF--MNQRLQTRLSEHEV 138

  Fly   141 LQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLS-DSFEPIIVDLGSMTEARLQIVGQTDAQRL 204
            |:|...:.:|:.::|...| ||.|||||..|:.|| ::|:  :.|.||:||........::.|.|
pombe   139 LKIISDIVQGVASLHYLRP-PLIHRDLKVENVLLSFNTFK--LCDFGSVTEPMHAAENSSEIQAL 200

  Fly   205 QDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLS 269
            :......::..|||||:..:.:...|||::|:|:||.:||.:||:.:|::   .:|.:   |:|:
pombe   201 EKSINTFTTYQYRAPEMINLYSGLGIDEKSDMWALGVLLYKLCYYTTPFE---TQGPN---AILT 259

  Fly   270 GNINIPEDSIYTEDMHELIKYMLRTDPMERPFVFSVI 306
            .:.:.|....|:..:..:|..:|:.:|..||.:|.::
pombe   260 ASYSFPPFPPYSHSLKNVIIALLQPNPCLRPNIFQLM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 84/295 (28%)
S_TKc 30..300 CDD:214567 81/286 (28%)
ppk29NP_001342923.1 PKc_like 21..304 CDD:328722 84/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.