DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and SIK3

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001353615.1 Gene:SIK3 / 23387 HGNCID:29165 Length:1369 Species:Homo sapiens


Alignment Length:279 Identity:76/279 - (27%)
Similarity:115/279 - (41%) Gaps:48/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALREIENCRKIDSENVIRVVD 92
            |.|...:..|.|:::....:..|:...|||.|....:|::|:  ..||::..:.:...::||:  
Human    66 YEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDKTQLDEENLKKIFREVQIMKMLCHPHIIRL-- 128

  Fly    93 YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGV----CEGLKA 153
            |:       |:.|...:::|..|...|.:.|||....|..:.....:..||...|    |..   
Human   129 YQ-------VMETERMIYLVTEYASGGEIFDHLVAHGRMAEKEARRKFKQIVTAVYFCHCRN--- 183

  Fly   154 IHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRA 218
                    :.|||||..|:.|..:....|.|.|.....       |..|.|:...   .|..|.|
Human   184 --------IVHRDLKAENLLLDANLNIKIADFGFSNLF-------TPGQLLKTWC---GSPPYAA 230

  Fly   219 PELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERG---DSVALAVLSGNINIPEDSIY 280
            ||||..|.|  ...:.||||||.|||.:.....|:|     |   .::...||||...||  ...
Human   231 PELFEGKEY--DGPKVDIWSLGVVLYVLVCGALPFD-----GSTLQNLRARVLSGKFRIP--FFM 286

  Fly   281 TEDMHELIKYMLRTDPMER 299
            :.:...||::||..||.:|
Human   287 STECEHLIRHMLVLDPNKR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 76/279 (27%)
S_TKc 30..300 CDD:214567 76/279 (27%)
SIK3NP_001353615.1 STKc_SIK 65..317 CDD:270973 76/279 (27%)
UBA_SIK3 346..390 CDD:270593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.