DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and gakh-1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_508971.1 Gene:gakh-1 / 180844 WormBaseID:WBGene00018516 Length:570 Species:Caenorhabditis elegans


Alignment Length:313 Identity:76/313 - (24%)
Similarity:145/313 - (46%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSIGWTLIMKRGCLFS------CRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIK 59
            :||:|      ||...|      .|.:|.:|||:.|.:.:.:|.|||..:.|..|...:: .|:|
 Worm    10 IQSVG------RGAGISEQSELYDRGQTFSINGNNYRVEKVIAKGGFGTVFLATNTKGKQ-VAVK 67

  Fly    60 RITCHSIDDQNIALREIENCRKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADH 124
            .:..|..........||:..:|:..||:|::.|...:.::.   |.:...:.:...|...|:||.
 Worm    68 IMLSHDAAATKDIDNEIDMMKKLQHENIIQLFDASAESRSS---NRSVKEYKISMEYCKFSIADV 129

  Fly   125 LQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMT 189
            |    .|...:....:::|.......|..:|.   |...|||:|..|:.::.:.:..:.|.||.|
 Worm   130 L----LKYKEVSIDFVVRIIYFTTRALVYLHS---VGAIHRDIKAENLLINGNGKLKLCDFGSAT 187

  Fly   190 EARLQIVGQTDAQRL--QDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSP 252
            ...:::...::::||  |:|..:.::.:.|:||:..|.:...|.::.|.|::||::|.:.:...|
 Worm   188 TKSIEMAPLSNSERLAVQEEMFKYTTPITRSPEVCDVYSNWPIGKQQDNWAMGCLIYFVAFGEHP 252

  Fly   253 YDPIYERGDSVALAVLSGNINIP------EDSIYTEDMHELIKYMLRTDPMER 299
            :       |..|||:::|....|      :.|.:.    :||...|..:|.||
 Worm   253 F-------DGSALAIINGKYKKPPPVQQNQLSAFA----DLIAKCLTPNPDER 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 65/279 (23%)
S_TKc 30..300 CDD:214567 65/278 (23%)
gakh-1NP_508971.1 PKc_like 38..304 CDD:389743 65/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.