DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and par-1

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001122967.2 Gene:par-1 / 179912 WormBaseID:WBGene00003916 Length:1216 Species:Caenorhabditis elegans


Alignment Length:299 Identity:74/299 - (24%)
Similarity:130/299 - (43%) Gaps:46/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SCRKETLNINGSRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALREIENC 79
            :.|:...:::..:|.:.:.:..|.|:.:.|.::..|....|||.|...:::..::  ..||::..
 Worm    93 AARRNDQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIM 157

  Fly    80 RKIDSENVIRVVDYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIF 144
            :::|..|::::  |:       |:.|..||::||.|...|.:.|:|....|.::....|:..|| 
 Worm   158 KQLDHPNIVKL--YQ-------VMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQI- 212

  Fly   145 LGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAE 209
                  :.|:.......:.|||||..|:.|.......|.|.|......|       ..:|.... 
 Worm   213 ------VSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSL-------GNKLDTFC- 263

  Fly   210 ERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVALAVLS 269
              .|..|.|||||:.|.|  .....|:||||.:||.:...:.|:|     .:.||       ||.
 Worm   264 --GSPPYAAPELFSGKKY--DGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRER-------VLR 317

  Fly   270 GNINIPEDSIY-TEDMHELIKYMLRTDPMERPFVFSVIE 307
            |...||   .| :.|...|:|..|..:|..|..:.::::
 Worm   318 GKYRIP---FYMSTDCENLLKKFLVINPQRRSSLDNIMK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 73/287 (25%)
S_TKc 30..300 CDD:214567 72/277 (26%)
par-1NP_001122967.2 STKc_MARK 105..357 CDD:270974 73/287 (25%)
S_TKc 106..357 CDD:214567 73/286 (26%)
MARK1-3_C 1117..1214 CDD:213381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.