DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and NEK7

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_016855833.1 Gene:NEK7 / 140609 HGNCID:13386 Length:310 Species:Homo sapiens


Alignment Length:314 Identity:77/314 - (24%)
Similarity:135/314 - (42%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SRYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI---ALREIENCRKIDSENVIR 89
            :.:.|.:::..|.||.:............|:|::....:.|...   .::||:..::::..|||:
Human    32 ANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIK 96

  Fly    90 -----VVDYELKGQADIVINTTST-------LFIVLPYYKHGSLADHLQLRSRKQDHM-PEAQIL 141
                 :.|.||    :||:.....       .|:.|.:.||          .:||..: ||..:.
Human    97 YYASFIEDNEL----NIVLELADAGDLSRMIKFLFLIFKKH----------FKKQKRLIPERTVW 147

  Fly   142 QIFLGVCEGLKAIHEAMPVPLAHRDLKTANICLSDSFEPIIVDLG------SMTEARLQIVGQTD 200
            :.|:.:|..|:.:|...   :.|||:|.||:.::.:....:.|||      |.|.|...:||   
Human   148 KYFVQLCSALEHMHSRR---VMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVG--- 206

  Fly   201 AQRLQDEAEERSSIVYRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVAL 265
                        :..|.:||......|   :.::|||||||:||.|....||:     .||.:.|
Human   207 ------------TPYYMSPERIHENGY---NFKSDIWSLGCLLYEMAALQSPF-----YGDKMNL 251

  Fly   266 AVLSGNIN------IPEDSIYTEDMHELIKYMLRTDPMERP---FVFSVIERTH 310
            ..|...|.      :|.|. |:|::.:|:...:..||.:||   :|:.|.:|.|
Human   252 YSLCKKIEQCDYPPLPSDH-YSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMH 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 77/313 (25%)
S_TKc 30..300 CDD:214567 71/297 (24%)
NEK7XP_016855833.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.