DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and aux

DIOPT Version :10

Sequence 1:NP_649712.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_310244.8 Gene:aux / 1271448 VectorBaseID:AGAMI1_009379 Length:1287 Species:Anopheles gambiae


Alignment Length:86 Identity:21/86 - (24%)
Similarity:36/86 - (41%) Gaps:24/86 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WIFAL-------------MVFLSNLFDKDVVGTIGKMK----LLILYVICLACLIISASLESWYI 107
            |:|.|             :|...:|...:||...|:||    :.:|.|:.|...::....:| ..
Mosquito    13 WLFELSERERDKVLCEQDLVIPVSLDQTNVVRLNGEMKSCAAIGVLLVLLLQYEVVRTDSDS-SD 76

  Fly   108 SRSGTTG----KH--PDHVYH 122
            |.|.::|    ||  .:|.|:
Mosquito    77 SSSSSSGEKKHKHSKTEHKYN 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_649712.1 STKc_16 29..314 CDD:270888 21/86 (24%)
auxXP_310244.8 None

Return to query results.
Submit another query.