DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and nek5

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_002936777.2 Gene:nek5 / 100497645 XenbaseID:XB-GENE-1012494 Length:931 Species:Xenopus tropicalis


Alignment Length:288 Identity:75/288 - (26%)
Similarity:123/288 - (42%) Gaps:42/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RYTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSI--DDQNIALREIENCRKIDSENVIRVV 91
            :|.|...:..|.|....|.:..|......||.|....:  .::..:.:|:....|:...|::...
 Frog     8 KYDIVRMIGEGAFGKAYLAKGKSDNMQCVIKEINLSKMPTKEKEASHKEVVLLAKMKHPNIVTFF 72

  Fly    92 DYELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHM--PEAQILQIFLGVCEGLKAI 154
            .         .|...:.|:||:.|...|.    |..|..||..:  .|.|||..|:.:..|||.|
 Frog    73 S---------SIEERNKLYIVMEYCDGGD----LMKRVNKQRGVLFEEDQILSWFVQISLGLKHI 124

  Fly   155 HEAMPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIV---- 215
            |:.   .:.|||:|..||.||::  ..:..||....||:          |.:..|...:.|    
 Frog   125 HDR---KVLHRDIKAQNIFLSNN--GTLAKLGDFGIARM----------LNNTMELARTCVGTPY 174

  Fly   216 YRAPELFTVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVALAVLSGNINIPEDSIY 280
            |.:||:...|.|   :.:|||||||||||.:|....|::....|  .:.|.:..|... |..:.|
 Frog   175 YLSPEICENKPY---NNKTDIWSLGCVLYELCALKHPFEASSLR--QLVLKICRGRYE-PIPTKY 233

  Fly   281 TEDMHELIKYMLRTDPMERPFVFSVIER 308
            :.|:..|:..:.:....:||.:.|::::
 Frog   234 SYDLRILVSQLFKISSRDRPSINSILKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 75/288 (26%)
S_TKc 30..300 CDD:214567 72/277 (26%)
nek5XP_002936777.2 PKc_like 8..264 CDD:389743 75/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.