DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and mark4

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_012824414.1 Gene:mark4 / 100491038 XenbaseID:XB-GENE-6042140 Length:681 Species:Xenopus tropicalis


Alignment Length:278 Identity:71/278 - (25%)
Similarity:115/278 - (41%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALREIENCRKIDSENVIRVVD 92
            |.:...:..|.|:.:.|..:..|.|..|||.|....::..::  ..||:...:.::..|::::.:
 Frog    51 YRLLRTIGKGNFAKVKLARHVLTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFE 115

  Fly    93 YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEA 157
                     ||.|..||::::.|...|.:.|:|....|.::....|:..||       :.|:|..
 Frog   116 ---------VIETEKTLYLIMEYASGGEVFDYLVSHGRMKEKEARAKFRQI-------VSAVHYC 164

  Fly   158 MPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELF 222
            ....:.|||||..|:.|.......|.|.|...|.       |...:|....   .|..|.|||||
 Frog   165 HQKNIVHRDLKAENLLLDSESNIKIADFGFSNEF-------TPGGKLDTFC---GSPPYAAPELF 219

  Fly   223 TVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVALAVLSGNINIPEDSIY-T 281
            ..|.|  .....|:||||.:||.:...:.|:|     .:.||       ||.|...||   .| :
 Frog   220 QGKRY--NGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRER-------VLRGKYRIP---FYMS 272

  Fly   282 EDMHELIKYMLRTDPMER 299
            .|...:::..|..:|.:|
 Frog   273 TDCEGVLRRFLVLNPSKR 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 71/278 (26%)
S_TKc 30..300 CDD:214567 71/278 (26%)
mark4XP_012824414.1 STKc_MARK 50..302 CDD:270974 71/278 (26%)
UBA_MARK_Par1 323..361 CDD:270522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.