| Sequence 1: | NP_001287207.1 | Gene: | CG1227 / 40872 | FlyBaseID: | FBgn0037491 | Length: | 320 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_012824414.1 | Gene: | mark4 / 100491038 | XenbaseID: | XB-GENE-6042140 | Length: | 681 | Species: | Xenopus tropicalis |
| Alignment Length: | 278 | Identity: | 71/278 - (25%) |
|---|---|---|---|
| Similarity: | 115/278 - (41%) | Gaps: | 46/278 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 30 YTIRERLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNI--ALREIENCRKIDSENVIRVVD 92
Fly 93 YELKGQADIVINTTSTLFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEA 157
Fly 158 MPVPLAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIVYRAPELF 222
Fly 223 TVKTYCTIDERTDIWSLGCVLYAMCYFNSPYD-----PIYERGDSVALAVLSGNINIPEDSIY-T 281
Fly 282 EDMHELIKYMLRTDPMER 299 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1227 | NP_001287207.1 | STKc_16 | 29..314 | CDD:270888 | 71/278 (26%) |
| S_TKc | 30..300 | CDD:214567 | 71/278 (26%) | ||
| mark4 | XP_012824414.1 | STKc_MARK | 50..302 | CDD:270974 | 71/278 (26%) |
| UBA_MARK_Par1 | 323..361 | CDD:270522 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||