DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1227 and LOC100486333

DIOPT Version :9

Sequence 1:NP_001287207.1 Gene:CG1227 / 40872 FlyBaseID:FBgn0037491 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_002936837.2 Gene:LOC100486333 / 100486333 -ID:- Length:494 Species:Xenopus tropicalis


Alignment Length:301 Identity:77/301 - (25%)
Similarity:137/301 - (45%) Gaps:48/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RLATGGFSLIDLGENASTRRSYAIKRITCHSIDDQNIALREIENCRKIDSENVI--RVVDYELKG 97
            ::..|..:.:.|..|..|:::||:|:|   .||:.    :.:.|...|..|..|  ::|...:..
 Frog     9 KIGRGATAEVFLMRNKETKKNYAVKKI---KIDES----KRLRNKESILQEATILGKLVHPHVVA 66

  Fly    98 QADIVINTTST-LFIVLPYYKHGSLADHLQLRSRKQDHMPEAQILQIFLGVCEGLKAIHEAMPVP 161
            ..:.:.:.... :|||..|...|:|.||  ::.|.....||..|:..|:.:...::.||.   :.
 Frog    67 CHECICDEEDEHIFIVQDYCDGGTLDDH--IKQRNGALFPEDTIMDWFIQLTMAVQYIHS---MK 126

  Fly   162 LAHRDLKTANICLSDSFEPIIVDLGSMTEARLQIVGQTDAQRLQDEAEERSSIV----YRAPELF 222
            :.|||:||:|:.|:   :..:|.||....:::          |....:..|:.|    |.:|||.
 Frog   127 ILHRDIKTSNVFLT---KKGMVRLGDFGISKV----------LSSTMDMASTCVGTPYYLSPELC 178

  Fly   223 TVKTYCTIDERTDIWSLGCVLYAMCYFNSPYDPIYERGDSVAL--AVLSGNINIPEDSIYTEDMH 285
            ....|   ..::|||:|||:||.||    ...|.:...:.::|  .::.|... |....|:.|:|
 Frog   179 QDIPY---SSKSDIWALGCLLYEMC----ALQPAFNAANLISLFFKIVKGEYP-PISDCYSIDLH 235

  Fly   286 ELIKYMLRTDPMERPFVFSVI------ERTHDLIQKLEGRL 320
            :|:|.:|...|..||....::      |:....|||.|.:|
 Frog   236 KLVKTILDKCPESRPSASCILNLSFVQEQLKLFIQKHESQL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1227NP_001287207.1 STKc_16 29..314 CDD:270888 72/293 (25%)
S_TKc 30..300 CDD:214567 69/273 (25%)
LOC100486333XP_002936837.2 STKc_Nek 3..261 CDD:270855 71/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.