DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG14880

DIOPT Version :8

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_650538.1 Gene:CG14880 / 41986 FlyBaseID:FBgn0038422 Length:637 Species:Drosophila melanogaster

Alignment Length:744 Identity:174/745 (23%)
Similarity:265/745 (36%) Gaps:224/745 (30%)


  Fly   105 IPKTSFSCRSYGNGYFADMETDCQVFHICEE-GRKISFLCPNGTIFQQSELTCDWWFKVNCLGSS 168
            |.||||||.....||:||:||.|||:|:|:. ||:.|:.|||.|:|||..|.||.|:.|||..:.
  Fly    44 IQKTSFSCAGRPAGYYADVETGCQVYHMCDGLGRQFSYTCPNTTLFQQRMLICDHWYMVNCSKAE 108

  Fly   169 GYYAESAEILNKQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRANPDRRIDSTED 233
            ..||  |.:|..||                     .||.|.......|:  ||  ||     ..|
  Fly   109 SNYA--ANLLIGQR---------------------DKPFVNDEENSLRT--PR--PD-----LLD 141

  Fly   234 VPASVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKESN-------- 290
            .|.:      .|.|||..|.......:|.|    ||..||   |.|:|..:::.:.:        
  Fly   142 RPYA------PDYSGESFRSQYKQFTSNQN----QIRDES---VKGAGAGKSDPQISQTRWRIPP 193

  Fly   291 PNRNDDITVLKP-------------ARLRTPVATQERGVSTERARNGQRGQHRYSGSEEHSKERE 342
            |:|    |:|.|             |:.|.|:.|..  .:|.||....|.......:...:..|.
  Fly   194 PSR----TILPPAYEPQIELPSAQSAKPRIPIITST--TTTTRATTTTRPTTTTRATTTTTTTRR 252

  Fly   343 RPTPGQSKE-----KPEFFE--------AHSTRSVPQTTAHYSTGSHSTVRRLEPS--KSTPFYT 392
            .|...:.||     :|.|.|        :||||.  .|:|.::: :.|.:|..:.|  |.|.|..
  Fly   253 PPVTARPKEALHNRRPNFQEHDMDDLGTSHSTRY--NTSADFNS-AESPLRETKQSSTKLTKFIK 314

  Fly   393 PTVPSLVKSKSTEGKLNY---------IKGGHVATT----------PNPHRFGSASSGIFIESSV 438
            |      .||..|....|         .:...||||          |.|.|...::      ::.
  Fly   315 P------PSKIYEPPFVYPIYNLEESQTQNAAVATTLRTSTAAPFSPVPSRKEVST------TTP 367

  Fly   439 APKVKPTASASIELDSTFKPVIIGMRHHYDVASSGEFRPPSKSTESRDYLPTTPSPSAASSGPTY 503
            .|..:||..|.:...|...|..:..   ..|....:.|.|:.:...|  |.|..|.:|..|.|..
  Fly   368 RPLSRPTTLAGVPFSSATHPTTVTT---VGVPPRSDNRTPAPAQSFR--LATPTSTAAPPSRPAQ 427

  Fly   504 LPMSGKSPRVNTGGAAGEDVLLFAPNPVKEESVFRNVQDMLKTMNLLKDQFEDVELNAAAAAPAR 568
            ||.:...|          ..:.|.|:            |:..|..  ...:.:.::.:....|.:
  Fly   428 LPFNDLLP----------PFVDFVPH------------DIATTQG--PPIYYEWKVPSNGLEPPK 468

  Fly   569 V-------GLEIPPSSGPDALVSFAKYFAQEHNETINSLSKKDK-----SEKVDKTGVQTKLSVK 621
            :       |.|.|.::|...:.|....|    |..:|.:....|     :..:.::....:|::.
  Fly   469 LDPPIGVDGREYPETTGDYGVTSKQDVF----NTRLNDIGSHQKKPVQITSPLQQSSTSHRLAIS 529

  Fly   622 PPLPTIKPSDTTALLTTSENPPAISDNADDIKKSLLSDTTVKKYSNLFGL----KSAQGRGAGES 682
               .:|||.:.........:..|.|.:...::|..|    :.:|:  |.|    ::..|.|||.:
  Fly   530 ---RSIKPKEEQESAQRRSDVVASSTDISHLRKQFL----IPEYA--FPLETIGRTGYGPGAGAA 585

  Fly   683 DISSGLLSNQTNGTQSEAGSKYQQYPQIGSTGSTIGALAEKPETRKIAQIFSNALSSYLDNPATF 747
                      ..|:.|..|..|..:.            .:.||.|  |:.|.       :||.. 
  Fly   586 ----------AGGSGSSNGDLYNSFQ------------LKIPEQR--AKWFG-------ENPKC- 618

  Fly   748 RAELAARARPTEPPSTPNFKPVTTTDPSL 776
                        |...|:|....|.:|.|
  Fly   619 ------------PECHPSFVLPGTCEPCL 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 28/53 (53%)
CG14880NP_650538.1 CBM_14 51..104 CDD:279884 28/53 (53%)
COG3979 336..>457 CDD:226487 30/156 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.