DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and mtg

DIOPT Version :8

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster

Alignment Length:182 Identity:56/183 (31%)
Similarity:86/183 (47%) Gaps:28/183 (15%)


  Fly   105 IPKTSFSC--RSYGNGYFADMETDCQVFHIC---EEG--RKISFLCPNGTIFQQSELTCDWWFKV 162
            :|.|||||  :.:..|.:||.:..|.|||:|   ::|  || |||||..|:|.|:.|.|:|||.|
  Fly   394 LPPTSFSCAKQKHFPGLYADTDLGCMVFHVCALTDDGMVRK-SFLCPENTLFDQTILKCNWWFYV 457

  Fly   163 NCLGSSGYYAESAEILNKQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRA-NPDR 226
            :|..|:..|..:..|   .:.:::..|:..  |:...||...:        ||......| :.|.
  Fly   458 DCSSSTSVYDSNIPI---SKSYQLMKSLTY--FSKYAGGQRHE--------QGGDKDENALDIDS 509

  Fly   227 RIDSTEDVPASVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVS 278
            ..:|.|.|....|.....::..|:||. :|     ..|.|..:.||:...:|
  Fly   510 LRESMEGVARRQEQAKKAELRVEEQRS-MP-----KEDHEHVVPAEAEQQLS 555

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 26/59 (44%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.