DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG13676

DIOPT Version :8

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_648179.3 Gene:CG13676 / 38906 FlyBaseID:FBgn0035844 Length:883 Species:Drosophila melanogaster

Alignment Length:1079 Identity:211/1080 (20%)
Similarity:327/1080 (30%) Gaps:382/1080 (35%)


  Fly    25 LIVLVILGYTSAESKY------RTP---ARILAKQTGATQFEEERYE---------AHTNCNEHK 71
            |::|.:|..|.|...:      :||   :...:..|.|...|||..|         :........
  Fly    15 LLLLSLLASTDAALPFKKVSIAKTPVSTSSTTSTTTEAPAVEEEEVEEEQPVPTADSSDGSKSDN 79

  Fly    72 HHLKKRASDEDVDYEVYQGVVGRPGIDFPIYPRIPK---------------------TSFSCRSY 115
            ..|.|.:.           :.|.|.||:...|.:|:                     ..|.|...
  Fly    80 GTLLKNSK-----------LTGIPQIDYIWDPNLPRELRGYNLSTYPFLSTVPPMDEIHFKCEGL 133

  Fly   116 GNGYFADMETDCQVFHICEEGRKISFLCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEI-LN 179
            .:|::|.:|..||::|.|..|.:..|||.|.|.|.|....|.:...|:|.||..|:..:.|: :.
  Fly   134 HDGFYASIEYKCQIYHHCVYGIRHDFLCANFTAFDQRTFICHFASDVDCEGSQKYWNRNDELYMA 198

  Fly   180 KQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRANPDRR----------------- 227
            .........:.|.             |...|.|.:.|...|: .|.||                 
  Fly   199 TTTTSTSTTTTPA-------------PPTLPPAPRRRPQRPQ-RPLRRPYNRRPIDDYYYEDQDQ 249

  Fly   228 --IDSTEDVPA------------SVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVS 278
              .|..|:.|.            .||. ::||...:|:.:....|..|.|....:..|....:..
  Fly   250 YEDDYYEERPVRRPKPRPRQRKPQVEP-EYDDEYDDKRTEAKKPIRRNRNRYRDEEEALDEDYDE 313

  Fly   279 GSGKRRTNKESNPNRNDDITVLKPARLRTPVATQERGVSTERARNGQR--GQHRYSGSEEHSKER 341
            ...||...|.:.......|:..||.|:      :||     |:.|..|  |:.|        .|:
  Fly   314 RPSKRPRGKPTAGTAGRKISPRKPGRV------EER-----RSFNEDRPLGRRR--------SEK 359

  Fly   342 ERPTPGQSKEKPEFFEAHSTRSVPQTTA-HYSTGSHSTVRRLE--PSKSTPFYTPTV-------- 395
            ||.||..:.:..:.:|.      |..:| ........|.::::  |...|.|.||..        
  Fly   360 ERTTPSSALDDLDEYEK------PYNSADQVEAAEEQTPQKVKTTPKPLTEFITPKAAAASVYAR 418

  Fly   396 ---------PSLVKSKSTEGKLNYIKGGHVATTPNPHRFGSASSGIFIESSVAPKVKPTASASIE 451
                     |..:..|.   |.:|......|||..|             |:.|.:.:......:|
  Fly   419 PRAPPRIARPVPINEKK---KFSYPVQKITATTQAP-------------SNSAQEEEDYPEEQVE 467

  Fly   452 LDSTFKPVIIGMRHHYDVASSGEFRPPSKSTESRDYLPTTPSPSAASSGPTYL----PMSGKSPR 512
            .|             |:       :||:::|..|    .||: |.|...||..    |::.|.|.
  Fly   468 ED-------------YE-------QPPARNTPRR----RTPA-SRAEQKPTRTTLRKPVTDKKPV 507

  Fly   513 VNTGGAAGEDVLLFAPNPVKEESVFRNVQDMLKT----MNLLKDQFEDVELNAAAAAPARVGLEI 573
            ........|      |.|:::..  |.:....:.    ::...:::|:.....:.|||.|     
  Fly   508 DEEYDEPAE------PEPLRKRK--RPLAPRSRVPAADVDFEDEEYEESPAPVSTAAPLR----- 559

  Fly   574 PPSSGPDALVSFAKYFAQEHNETINSLSKKDKSEKVDKTGVQTKLSVKPPLPTIKP--SDTTALL 636
                                |:.:.:           ||  .|:....||.|. ||  .|...| 
  Fly   560 --------------------NQRLRA-----------KT--TTRKPTAPPRPR-KPIVEDEEEL- 589

  Fly   637 TTSENP-PAISDNADDIKKSLLSDTTVKKYSNLFGLKSAQGRGAGESDISSGLLSNQTNGTQSEA 700
               |:| .|:.|.|...:....|             .|.:..|||.|...|.:...:.....|..
  Fly   590 ---EHPVEAVEDEAPAPRSRANS-------------LSGRNAGAGFSQRPSSVRVVKRPFLPSRG 638

  Fly   701 GSKY------------QQYPQIGST----GSTIGALAEKPETRKIAQIFSNALSSYLDNPATFRA 749
            ||.|            :..|...||    ||||..:          ::..:.......||.:...
  Fly   639 GSPYLPRGLQPVGVALKPLPTTDSTPIDMGSTISGV----------RLLEHGAPLLRGNPDSGED 693

  Fly   750 ELAARARPTEPPSTPNFKPVTTTDPSLFSDGTAKYYLPTKGLPDATTPTPNSIAAEINHKFDSTL 814
            :      ..:.|.:|: .|.||..|......|.|...|.:...:......|.....:|...|.||
  Fly   694 D------EEDAPPSPS-PPRTTLPPRSALPATPKRVEPQRPKLNLDELYENDYDVTLNDALDPTL 751

  Fly   815 APEFSTTTELYEGSTNRGLEFSGELSP--PSQDSGEEFLQQQQTQSFVKSRNDLLKDARPQKLVT 877
            .|                      |||  |...|.:...||||.||             .::..:
  Fly   752 KP----------------------LSPQHPHPHSHQLPYQQQQQQS-------------QRQYAS 781

  Fly   878 THKPTEHPWALKSQTDFLDPLTINDGLMKEQRTSTSSSTTSTSTTASPFAYRVTTPTPSRYEWED 942
            .:.|..:..|.:|.|                 ::::|:..|.|..||             |..:.
  Fly   782 AYNPFAYQPAYQSPT-----------------SASASAPASASQAAS-------------YHSDS 816

  Fly   943 IFRSYDIPRDAL----------------------PSSSG 959
            .|.|.||.|.|:                      |||.|
  Fly   817 YFSSTDIRRRAIVPAQTARPHRLEYAAAGGAAGGPSSGG 855

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 18/52 (35%)
CG13676NP_648179.3 CBM_14 130..182 CDD:279884 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.