DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG5756

DIOPT Version :8

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_611292.2 Gene:CG5756 / 37064 FlyBaseID:FBgn0034301 Length:1220 Species:Drosophila melanogaster

Alignment Length:1076 Identity:222/1077 (21%)
Similarity:362/1077 (34%) Gaps:347/1077 (32%)


  Fly    62 EAHTNCNEHKHHLKKRASDEDVDYEVYQGVVGRPGIDFPIYPRIPKTSFSCRSYGNGYFADMETD 126
            :|.:...||.....|.:...|..:::...:.|.||:|:||....|:|||.|:....||:||:|:.
  Fly    20 QAQSGSREHFEDADKSSEYTDQQFDLRHTIPGEPGLDYPILSSPPRTSFVCKGRHEGYYADVESR 84

  Fly   127 CQVFHICEEGRK----ISFLCPNGTIFQQSELTCDWWFKVNCLGSSGYYAESAEIL---NKQRVH 184
            ||.|.||....:    ..|||||||:|.|....|||:..|||..|..||..:.|..   ..:.:.
  Fly    85 CQAFRICAHTARSPQGFGFLCPNGTLFSQKNFVCDWYRNVNCDDSEKYYEMNEEKTVGSTHEMME 149

  Fly   185 RVRPSV--PVQGFN------------------------------------------IVGGGLNIK 205
            |||..:  |::..:                                          :||.|.::|
  Fly   150 RVRHMMEYPMKTISKALQQTQSQSQNPHHSLSKDLSGASGVLSQPAAIKLNDPETQVVGRGEDVK 214

  Fly   206 PKVTPVAGQGRSAAPRANPDRRI--DSTEDVPASVESVDFDDVSG------------EKQRKVLP 256
            .:.......| |..|..:.|..|  :|..:: :|...:.||..:.            :||:....
  Fly   215 SEPLSAVQLG-SINPGDSEDEGIYVNSLGEL-SSDPGIQFDHTNAHIVAEYPREYHYQKQKNFAE 277

  Fly   257 SI--------DNNSNDQESQITAESSSFVSGSGKRRTNKE-------SNPNR-NDDITV------ 299
            .:        |:.||..|    |.:..::...  |.|..|       ||.|. .|:::.      
  Fly   278 RVNAGLDILTDSESNSGE----AMAPDYIKHI--RNTKDEAVQLDLVSNINNLLDEVSTDVDPSI 336

  Fly   300 -----LKPARLRTPVATQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSKEKPEFFEAH 359
                 :.|.:::.|.....||.|.:| .||     :.|.|..:...:.:.||...:..|....|.
  Fly   337 SGYQSMAPPKVKQPFRFLSRGFSMQR-ENG-----KGSSSSGYGYIKPKQTPSTVRFTPNEIPAE 395

  Fly   360 STRSV------PQTTAHYSTGSHSTVRRLEPSKSTPFYTPTVPSLVKSKSTEGKLNYIKGGHVAT 418
            ..:|:      |::|:..||.|.:|....| |.......||:|     .:.:.:::.:....|.:
  Fly   396 DHKSIEHKHTFPKSTSTSSTTSTTTESATE-SIEHLLIAPTLP-----PAEDEEVSTLVASEVTS 454

  Fly   419 TPNPHRFGSASSGIFIESSVAPKVKPTASASIELDSTFKPVIIGMRHHYDVASSGEFRPPSKSTE 483
            ||       |:..:.:   :||.:.                        :|.::||        |
  Fly   455 TP-------AAEPLKV---LAPPLS------------------------EVVTAGE--------E 477

  Fly   484 SRDYLPTTPSPSAASSGPTYLPMSGKSPRVNTGGAAGEDVLLFAPNPVKEES---VFRNVQDMLK 545
            |     ...|...|::....||:|....||.....|.|      .|...:|:   :...||  |.
  Fly   478 S-----AIESIGQAAALTASLPISEDIVRVEQSSEASE------KNDAHQEAAKLLLAGVQ--LT 529

  Fly   546 TMNLLKDQFEDVELNAAAAAPARVGLEIPPSSGPDALVSFAKYFAQEHNETINSLSKKDKSEKVD 610
            :.|   |: :.:|.|............|.|     .:|:..:...:     |:|..::.:..:.:
  Fly   530 SHN---DE-QHLERNEVVVTSTTTASPITP-----VMVTSTEVVTE-----ISSTQERIRGYRRN 580

  Fly   611 KTGVQTKLSVKPPLPTIKPSDTTALLTTSENPPAISD----NADDIKKSLLSD------------ 659
            :.||..|.:...||||::  .|||..|.....|..|.    .|..::.|.||.            
  Fly   581 RPGVMLKRAHIRPLPTVR--TTTAATTPRSTTPTRSYLERLAASRLRLSRLSQATRSTAKATTTL 643

  Fly   660 ----------TTVKKYSNLFGLKSAQGRGAGESDISSGL----LSNQTNGTQSEAG-----SKYQ 705
                      |||..:..:        ||..|...:..|    :..:|....|:|.     |..|
  Fly   644 PSTTTTPATTTTVSSFQQI--------RGGAEPGPNKRLTVRDIDRETKVAPSKANWETVHSNLQ 700

  Fly   706 QYP-QIGSTGSTIGALAEKPETRKIAQI-FSNA--LSSYLDNPATFRAELAARARPTEPPSTPNF 766
            ::. |.|:...|       |.||  |.: .|||  .||....|.::.|..:.||..........:
  Fly   701 RFQVQRGNRVYT-------PATR--ASVGSSNAATTSSTTSAPRSYIAATSTRATVNVNRGKNRY 756

  Fly   767 KPVTTTDPSLFSDGTAKYYLPTKGLPDATTPTPNSIAAEINHKFDSTLAPEFSTTTELYEGSTNR 831
            ....|..|...:.||.         ..:||..|.|..:.:|... |.||..:           |.
  Fly   757 SNFKTQAPVQRTRGTT---------TTSTTQRPTSSLSSLNQHI-SALASNY-----------NG 800

  Fly   832 GLEF--SGELSPPSQDSGEEFLQQQQTQSFVKSRNDLLKDARPQKLVTTHKPTE---HPWALKSQ 891
            |..:  :.::|.|...|                         |..:..||..::   |       
  Fly   801 GYSYNQATQISKPIPQS-------------------------PSHVYATHTASDIAGH------- 833

  Fly   892 TDFLDPLTINDGLMKEQRTSTSSSTTSTSTTASPFAYRVTTPTPSRYEWEDIFRSYDIPRDALPS 956
                               ::.|.|||:.|.||.|.                  |:|....|:..
  Fly   834 -------------------ASQSQTTSSLTPASAFL------------------SFDKLTRAIVD 861

  Fly   957 SSGLQRIANKLFGGLNE----QEALHLRNVMAKAEH 988
            .|.||...:....|.|:    |.....::.:||.:|
  Fly   862 ESVLQNFKSAQSQGSNQAQQNQRQQQQQHQVAKQQH 897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 25/56 (45%)
CG5756NP_611292.2 CBM_14 70..126 CDD:279884 25/56 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131030206
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.