DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment thw and CG8192

DIOPT Version :8

Sequence 1:NP_001097699.2 Gene:thw / 40868 FlyBaseID:FBgn0037487 Length:1137 Species:Drosophila melanogaster
Sequence 2:NP_611047.2 Gene:CG8192 / 36723 FlyBaseID:FBgn0034030 Length:431 Species:Drosophila melanogaster

Alignment Length:481 Identity:92/482 (19%)
Similarity:156/482 (32%) Gaps:188/482 (39%)


  Fly    55 QFEEERYE-------AHTNCNEHKHH------LKKRASDEDVDYEVYQGVVGRPGIDFP--IYPR 104
            ::.||..|       |:.|..:..::      |||..|:|..:.|        ..::.|  :...
  Fly    83 EYSEEDQEEAPRPVYANRNAKQQSNYLKIQGQLKKPLSEESEEEE--------EEVEEPDRLSTL 139

  Fly   105 IPKTSFSCRSYGNGYFADMETDCQVFHICEEGRKISFLCPNGTIFQQSELTCDWWFKVN-CLGSS 168
            :.|:||||....:||:||....|:|||.|:|.:|.|::||.|..|.|..|.|......| |..||
  Fly   140 LSKSSFSCTDRNSGYYADESLSCEVFHYCQESQKHSWICPEGFTFHQIHLICMPPSHDNICKQSS 204

  Fly   169 GYYAESAEI---LNKQRVHRVRPSVPVQGFNIVGGGLNIKPKVTPVAGQGRSAAPRANP------ 224
            .|:..:..:   :|.|. |:.:|:|.::                        .:.|..|      
  Fly   205 KYHIVNDYLYKPINLQE-HQSKPNVTLR------------------------YSERYFPENYYEH 244

  Fly   225 DRRIDSTEDVPASVESVDFDDVSGEKQRKVLPSIDNNSNDQESQITAESSSFVSGSGKRRTNKES 289
            :|..|..|.:||:..                |.|....:.|:.|...:.        .|:.....
  Fly   245 ERYDDEEEQLPAAPR----------------PRIQQQHHQQQHQQPQQQ--------HRQVLAYQ 285

  Fly   290 NPNRNDDITVLKPARLRTPVATQERGVSTERARNGQRGQHRYSGSEEHSKERERPTPGQSKEKPE 354
            .|.:...:.|                              :|...::|...:::..| |::...:
  Fly   286 QPQQQPQVRV------------------------------QYQQPQQHQHHQQQAQP-QAQVVTQ 319

  Fly   355 FFEAHSTRSVPQTTAHYSTGSHSTVR-----------RLEPSKSTP-FYTPTVPSLVKSKSTEGK 407
            .  .|..:..|.|.|:......:||:           :|:..:..| ...|||            
  Fly   320 I--RHQPQPQPTTLAYRKPQPVTTVQPQLQLHQLHQPQLQLHQQRPQTLAPTV------------ 370

  Fly   408 LNYIKGGHVATTPNPHRFGSASSGIFIESSVAPKVKPTASASIELDSTFKPVIIGMRHHYDVASS 472
                       ||.|:||.:|          ||:::                      |......
  Fly   371 -----------TPAPYRFFTA----------APQLQ----------------------HLQQQQQ 392

  Fly   473 GEFRPPSK---STESRD---YLPTTP 492
            ..||.|.:   |.:.|.   ::.|||
  Fly   393 QVFRTPEEINISLQQRRPQVFIATTP 418

Known Domains:


GeneSequenceDomainRegion External IDIdentity
thwNP_001097699.2 CBM_14 112..164 CDD:279884 21/53 (40%)
CG8192NP_611047.2 CBM_14 147..200 CDD:279884 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22933
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.