DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14606 and CG33282

Sequence 1:NP_001334690.1 Gene:CG14606 FlyBaseID:FBgn0037485 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001097067.1 Gene:CG33282 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster

Alignment Length:459 Identity:191/460 (42%)
Similarity:293/460 (64%) Gaps:9/460 (2%)


  Fly     8 KLSVFSVRYRWQFIATMTVHIMTLTHGIAVGWLSPSLRLLASDESPLGDPLTITQASWVGSLIGL 72
            |.|:...:.|:|.:||:.|:|:|..||:.||||||:|..:.:.:|||...:.:.|.||:||::||
  Fly     6 KNSLLQQKTRYQLLATVIVNIITFGHGVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGSMLGL 70

  Fly    73 GSLTGNIIFGLLLDRLGRKVCMYFLAIPNMIYWILIYSAQDVTYLYAGRFLAGMSGGGCYVVLPI 137
            .||.||:...:|::|.|||.|:|.:|.|....|||||.|.:|.||||.|||.|.:||..|:|:||
  Fly    71 DSLCGNLTIAMLIERAGRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGAGYLVVPI 135

  Fly   138 FIAEIADNSVRGALSSMAMMYVSIGMMVGFTLASYLPYYLMPCIIVALPVVFMLSVIGLSETPQY 202
            ||:|:||:::||||:||.|:.|.:|::.|:.|::||.|:::|.:.:.|||.:.::.|.|.||..|
  Fly   136 FISEVADSNIRGALTSMVMLSVDLGILAGYILSTYLAYHVVPFLAIILPVAYFIANIMLPETAPY 200

  Fly   203 LLRRGRDDQAEKSFYFYKNLTPPTSSDKEASQHDAAKIEFDTFRLQVLSGGVTES--ISWRDFIN 265
            ||::.:...||.||.:|:|       .:.|.....:|:.|:..|..|||.....:  :|::|...
  Fly   201 LLKKSQLAAAENSFRYYRN-------QRSAICEQTSKVNFEELRTAVLSQQTRNATPLSYKDLTT 258

  Fly   266 VPTLKIFGLIFVLIICNQLSGSFAIFNYTSHIFAELGNNLDPNTSTIVVGAAQLVGIFSAVVLVD 330
            .|.||.|....||.:..|.||.|:..||.|.||...|:.:|.||:||::|..|:||::::.:|||
  Fly   259 KPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIGLVQIVGVYTSTILVD 323

  Fly   331 RLGRRVLLLTSMGGMGLGELAIALLKCFASDEFLNQNGWLPLVIMCLVACIASLGVIALIFIIII 395
            .:|||||:|.|..|:|:|.:|.......|....|:...|||||:|.::..:|::|:|.:.|::::
  Fly   324 IVGRRVLMLISTMGVGIGCIAFGCFTYLAKIYDLSDFNWLPLVLMIIICYVANIGLIGIFFLVLV 388

  Fly   396 ELLPAKIRSIGTSLSMATFSGFIFVALKIYPTMIYDQGLAATMFMSAGMCLFGFIVLGLFLPETK 460
            ||.|.||||:.||||:...|..:|..||::|.|::..|::.||:.||...|..|....|||.|||
  Fly   389 ELFPVKIRSLATSLSVIFLSLLVFGTLKLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETK 453

  Fly   461 GKLM 464
            ||.|
  Fly   454 GKSM 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14606NP_001334690.1 None
CG33282NP_001097067.1 MFS 21..448 CDD:119392 178/434 (41%)
MFS_1 53..409 CDD:284993 149/363 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131292381
eggNOG 1 0.900 E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D430696at2759
OrthoFinder 1 1.000 FOG0000041
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23500
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.