DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and GPN2

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_014905.1 Gene:GPN2 SGDID:S000005788 Length:347 Species:Saccharomyces cerevisiae

Alignment Length:335 Identity:110/336 (33%)
Similarity:168/336 (50%) Gaps:84/336 (25%)


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            |.||||::||.||||||||:...|:.....|:.||||:|||.:...|....||||.|.|::.|::
Yeast     1 MPFAQIVIGPPGSGKSTYCNGCSQFFNAIGRHSQVVNMDPANDALPYPCAVDIRDFITLEEIMQE 65

  Fly    66 EELHYGPNGGLIFCLE--------FLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELF 122
            ::|  ||||||::.:|        |:::.:..::|:..              |::||.|||:|||
Yeast    66 QQL--GPNGGLMYAVESLDNSIDLFILQIKSLVEEEKA--------------YLVFDCPGQVELF 114

  Fly   123 TH--------LKMGRQLVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHIN 179
            ||        .||.::|       :.|.|||..:|..:|...:::||..:.||..|..|:.||||
Yeast   115 THHSSLFNIFKKMEKEL-------DIRFCVVNLIDCFYMTSPSQYISILLLALRSMLMMDLPHIN 172

  Fly   180 VLTKVDLLSSDAR--------------KQLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGAL 230
            |.:|:|:|.|...              ..||.|:|.:..|::         |:||:|||:.|..|
Yeast   173 VFSKIDMLKSYGELPFRLDYYTEVQDLDYLEPYIEKEGSSVL---------GKKYSKLTETIKEL 228

  Fly   231 IEDFSLVRFFPLDSQDEESVGDLLLQIDSILQY-------GED-------------ADVNVKD-- 273
            :.||:||.|..|...|:||:.:|...||....|       |.|             |:.:::|  
Yeast   229 VSDFNLVSFEVLSVDDKESMINLQGVIDKANGYIFGASEVGGDTVWAEASREGALIANYDIQDRW 293

  Fly   274 FDEPEEGDQD 283
            .|..|:.|::
Yeast   294 IDNKEKYDKE 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 77/224 (34%)
ATP_bind_1 7..263 CDD:281079 97/286 (34%)
GPN2NP_014905.1 ATP_bind_1 7..261 CDD:308588 97/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.