DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and GPN3

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_013344.1 Gene:GPN3 SGDID:S000004233 Length:272 Species:Saccharomyces cerevisiae

Alignment Length:283 Identity:113/284 (40%)
Similarity:174/284 (61%) Gaps:20/284 (7%)


  Fly     2 RFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDE 66
            |...:::||||:||||:|:.:..:.....|...:||||||||...|....||||||.|||.||:.
Yeast     3 RVGVMVLGPAGAGKSTFCNSIISHMQTVGRRAHIVNLDPAAEATKYEFTIDIRDLISLDDVMEEM 67

  Fly    67 ELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQL 131
            :|  ||||.||:|.|:|::|.:||.|:         :|:.:|:|::||.||||||:||:.:...:
Yeast    68 DL--GPNGALIYCFEYLLKNLDWLDEE---------IGDFNDEYLIFDCPGQIELYTHIPVLPNI 121

  Fly   132 V-ELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDA-RKQ 194
            | .|.:..||..|..:.|::.|::|.:||.||.::|:|.|..:|.||||||:|:||:..|. :|:
Yeast   122 VRHLTQQLNFNLCATYLLEAPFVIDSSKFFSGALSAMSAMILLELPHINVLSKLDLIKGDINKKK 186

  Fly   195 LEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDS 259
            |:.:|.|||..||....:......|:.:|.|.|..|::||.:|:|.||:|.:.:|:..:|..:|.
Yeast   187 LKRFLNPDAMLLMETEGMNQASNPKFLRLNQCIANLVDDFGMVQFLPLESNNPDSIETILSYVDD 251

  Fly   260 ILQYGEDADVNVKDFDEPEEGDQ 282
            |.|:.|..       ::.|..||
Yeast   252 ITQWAEGQ-------EQKEPNDQ 267

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 86/196 (44%)
ATP_bind_1 7..263 CDD:281079 108/258 (42%)
GPN3NP_013344.1 ATP_bind_1 8..255 CDD:308588 108/258 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8218038
eggNOG 1 0.900 E1_KOG1534
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 219 1.000 Inparanoid score I769
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T1136395
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.