DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and AT4G12790

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001031621.1 Gene:AT4G12790 AraportID:AT4G12790 Length:271 Species:Arabidopsis thaliana

Alignment Length:284 Identity:130/285 (46%)
Similarity:190/285 (67%) Gaps:15/285 (5%)


  Fly     1 MRFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMED 65
            |.:||:::||||||||||||.:.::.....|.:.|||||||||.|.|....|||:||.|:|.|||
plant     1 MGYAQLVIGPAGSGKSTYCSSLYEHCETIGRTMHVVNLDPAAEIFNYPVAMDIRELISLEDVMED 65

  Fly    66 EELHYGPNGGLIFCLEFLIEN-QEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGR 129
              |..||||.|::|:|:|.:: .:|:.|:|   ||     ..||||::||.|||||||||:.:.:
plant    66 --LKLGPNGALMYCMEYLEDSLHDWVDEEL---EN-----YRDDDYLIFDCPGQIELFTHVPVLK 120

  Fly   130 QLVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQ 194
            ..||.|:..||..|||:.|||||:.|..|||||.|::|:.|..:|.||:|:|:|:|||..  :..
plant   121 NFVEHLKQKNFNVCVVYLLDSQFITDVTKFISGCMSSLAAMIQLELPHVNILSKMDLLQD--KSN 183

  Fly   195 LEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDS 259
            ::.||.|:..:|:.||  ....|.:||||.:|:..::.::.:|.|.|::.:.|:|:..:|.|||.
plant   184 IDDYLNPEPRTLLAEL--NKRMGPQYAKLNKALIEMVGEYGMVNFIPINLRKEKSIQYVLSQIDV 246

  Fly   260 ILQYGEDADVNVKDFDEPEEGDQD 283
            .:|:|||||||:||.|:..:...|
plant   247 CIQFGEDADVNIKDDDDFSDDGPD 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 96/195 (49%)
ATP_bind_1 7..263 CDD:281079 116/257 (45%)
AT4G12790NP_001031621.1 Gem1 3..211 CDD:224025 107/222 (48%)
ATP_bind_1 7..250 CDD:281079 116/257 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 249 1.000 Inparanoid score I1004
OMA 1 1.010
OrthoDB 1 1.010 D964931at2759
OrthoInspector 1 1.000 T193614
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.