DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and gpn2

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_012812548.1 Gene:gpn2 / 595033 XenbaseID:XB-GENE-5751862 Length:318 Species:Xenopus tropicalis


Alignment Length:270 Identity:102/270 - (37%)
Similarity:148/270 - (54%) Gaps:22/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNP--LTDIRDLIHLDDAMED 65
            |.|.::||.|||||||...||.......|...::|||||.|.   .|  ...:|:|:.|::.|  
 Frog    20 FGQAVIGPPGSGKSTYVRAMQALLAQMGRKSAIINLDPAGED---EPGAAVSLRELLGLEEVM-- 79

  Fly    66 EELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQ 130
            .||..||||.|::|:|:|.||.:||:.:|.|...         .|.|.|.|||:||:||......
 Frog    80 SELRLGPNGALLYCMEYLQENLDWLRGRLQGLRG---------TYFLLDCPGQVELYTHHPALPD 135

  Fly   131 LVELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK-- 193
            ::..|.:|..|.|.|..:||.:..|.|||||....:||.|.::|.||||||:|:||:....|.  
 Frog   136 VLRRLGAWGLRLCAVHLVDSHYCTDPAKFISVLCTSLSTMLHVELPHINVLSKMDLIEQYGRLAF 200

  Fly   194 QLEMYLE-PDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQI 257
            .|:.|.| .|...|:.:|| ...|..::.:|.:.:..:|:|:.||.|.||..:||:|:..:|..:
 Frog   201 NLDYYTEVMDLSYLVEQLT-SDPFFRRHKRLHEKLAEVIQDYGLVTFMPLSIKDEKSLRLVLSAV 264

  Fly   258 D--SILQYGE 265
            |  |...:||
 Frog   265 DKASGFCFGE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 78/196 (40%)
ATP_bind_1 7..263 CDD:281079 98/262 (37%)
gpn2XP_012812548.1 GPN2 20..266 CDD:349780 98/260 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.