DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and PPP4R3B

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001116436.3 Gene:PPP4R3B / 57223 HGNCID:29267 Length:849 Species:Homo sapiens


Alignment Length:122 Identity:30/122 - (24%)
Similarity:51/122 - (41%) Gaps:22/122 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 NMEQPHINVL----TKVDLLSSDARKQLEMYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIE 232
            |:.:|.||.|    |:.:||:|...:..|.....|..||...:.      |.:.|..::| ..::
Human   613 NLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIV------ENFYKALESI-EYVQ 670

  Fly   233 DFSLVRFFPLDSQDEESVGDLLLQIDSIL---QYGEDADVNVKD------FDEPEEG 280
            .|..::  ....|:::.....|..:.|||   ::..||....:|      .||.|||
Human   671 TFKGLK--TKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEG 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 9/27 (33%)
ATP_bind_1 7..263 CDD:281079 22/97 (23%)
PPP4R3BNP_001116436.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 714..849 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.