DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and gpn3

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001017191.1 Gene:gpn3 XenbaseID:XB-GENE-973716 Length:285 Species:Xenopus tropicalis

Alignment Length:282 Identity:145/283 (51%)
Similarity:195/283 (69%) Gaps:15/283 (5%)


  Fly     2 RFAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDE 66
            |:||:::||||||||||||.|.|:.....|:|||||||||||||.|..|.|||:||.:||.|||.
 Frog     3 RYAQLVMGPAGSGKSTYCSTMVQHCGSLNRSVQVVNLDPAAEHFDYPVLADIRELIEVDDVMEDR 67

  Fly    67 ELHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQL 131
            .|.:||||||::|:|:...|.:||         |..:|..:|||||||.||||||:|||.:.:.|
 Frog    68 SLRFGPNGGLVYCMEYFANNFDWL---------ESCLGHTEDDYILFDCPGQIELYTHLPVMKYL 123

  Fly   132 VELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQLE 196
            ||.|:.|.||.|.||.:||||||:..||:||.:||||.|.::|.|..|::||:|||...|:|::|
 Frog   124 VEQLQQWEFRVCGVFLVDSQFMVESFKFLSGVLAALSAMVSLEIPQCNIMTKMDLLGKKAKKEIE 188

  Fly   197 MYLEPDAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSIL 261
            .:|:||.:|:: |.|.......|:.|||:|:..||:|:|:|||.|.|..|||.:..:|..||..:
 Frog   189 KFLDPDMYSMI-EDTSNRFKSNKFKKLTEALCGLIDDYSMVRFLPFDRSDEECMNIVLQHIDFAI 252

  Fly   262 QYGEDADVNVKDFDEPEEGDQD 283
            |||||.     :|.||:|.::|
 Frog   253 QYGEDL-----EFKEPKENEED 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 108/194 (56%)
ATP_bind_1 7..263 CDD:281079 133/256 (52%)
gpn3NP_001017191.1 ATP_bind_1 8..254 CDD:308588 133/256 (52%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. {ECO:0000250|UniProtKB:Q9UYR9} 72..74 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8217401
eggNOG 1 0.900 E1_KOG1534
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 293 1.000 Inparanoid score I2582
OMA 1 1.010
OrthoDB 1 1.010 D432496at33208
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T1060257
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.