DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and GPN2

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_060536.3 Gene:GPN2 HGNCID:25513 Length:310 Species:Homo sapiens

Alignment Length:265 Identity:103/266 (39%)
Similarity:146/266 (55%) Gaps:17/266 (6%)


  Fly     3 FAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEE 67
            |.|.::||.||||:|||..|.::.....|.|.|||||||.|...|....|:.:|:.|.|.|  :.
Human    10 FGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVM--DA 72

  Fly    68 LHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEP-DDDYILFDMPGQIELFTHLKMGRQL 131
            |..||||||::|:|:|..|.:||:.:|          :| ...|.|||.|||:||.||....|.:
Human    73 LRLGPNGGLLYCMEYLEANLDWLRAKL----------DPLRGHYFLFDCPGQVELCTHHGALRSI 127

  Fly   132 VELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK--Q 194
            ...:..|:.|...|..:||.:..|.|||||....:|:.|.::|.||||:|:|:||:....:.  .
Human   128 FSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFN 192

  Fly   195 LEMYLEP-DAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQID 258
            |:.|.|. |...|:..|. ...|...|.:|.:.:..||||:|||.|.||:.||:||:..:|..:|
Human   193 LDYYTEVLDLSYLLDHLA-SDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAVD 256

  Fly   259 SILQY 263
            ....|
Human   257 KANGY 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 78/196 (40%)
ATP_bind_1 7..263 CDD:281079 100/260 (38%)
GPN2NP_060536.3 Gem1 13..182 CDD:224025 74/181 (41%)
ATP_bind_1 14..261 CDD:281079 100/260 (38%)
Gly-Pro-Asn (GPN)-loop, involved in dimer interface. {ECO:0000250|UniProtKB:Q9UYR9} 76..78 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D432496at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.