DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG2656 and GPN3

Sequence 1:NP_649699.1 Gene:CG2656 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001157844.1 Gene:GPN3 HGNCID:30186 Length:323 Species:Homo sapiens

Alignment Length:269 Identity:138/270 (51%)
Similarity:188/270 (70%) Gaps:15/270 (6%)


  Fly    15 KSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEELHYGPNGGLIFC 79
            :||||:.|.|:.....|:|||||||||||||.|:.:.|||:||.:||.|||:.|.:||||||:||
Human    55 QSTYCATMVQHCEALNRSVQVVNLDPAAEHFNYSVMADIRELIEVDDVMEDDSLRFGPNGGLVFC 119

  Fly    80 LEFLIENQEWLKEQLCGGENELMVGEPDDDYILFDMPGQIELFTHLKMGRQLVELLESWNFRTCV 144
            :|:...|.:||         |..:|..:|||||||.||||||:|||.:.:|||:.||.|.||.|.
Human   120 MEYFANNFDWL---------ENCLGHVEDDYILFDCPGQIELYTHLPVMKQLVQQLEQWEFRVCG 175

  Fly   145 VFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARKQLEMYLEPDAHSLMGE 209
            ||.:||||||:..|||||.:||||.|.::|.|.:|::||:||||..|:|::|.:|:||.:||:.:
Human   176 VFLVDSQFMVESFKFISGILAALSAMISLEIPQVNIMTKMDLLSKKAKKEIEKFLDPDMYSLLED 240

  Fly   210 LTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQIDSILQYGEDADVNVKDF 274
            .|.... .:|:.|||:||..||:|:|:|||.|.|..||||:..:|..||..:|||||.     :|
Human   241 STSDLR-SKKFKKLTKAICGLIDDYSMVRFLPYDQSDEESMNIVLQHIDFAIQYGEDL-----EF 299

  Fly   275 DEPEEGDQD 283
            .||:|.:.:
Human   300 KEPKEREDE 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 100/181 (55%)
ATP_bind_1 7..263 CDD:281079 130/248 (52%)
GPN3NP_001157844.1 ATP_bind_1 56..293 CDD:281079 130/247 (53%)
Gem1 56..249 CDD:224025 107/203 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C8217664
eggNOG 1 0.900 E1_KOG1534
Hieranoid 1 1.000
Homologene 1 1.000 H6487
Inparanoid 1 1.050 301 1.000 Inparanoid score I2654
Isobase 1 0.950 0 Normalized mean entropy S519
OMA 1 1.010
OrthoDB 1 1.010 D432496at33208
OrthoFinder 1 1.000 FOG0004261
OrthoInspector 1 1.000 T1074178
orthoMCL 1 0.900 OOG5_128003
Panther 1 1.100 LDO PTHR21231
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R521
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.