| Sequence 1: | NP_649699.1 | Gene: | CG2656 / 40857 | FlyBaseID: | FBgn0037478 | Length: | 283 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001246599.1 | Gene: | eIF5B / 44261 | FlyBaseID: | FBgn0026259 | Length: | 1144 | Species: | Drosophila melanogaster |
| Alignment Length: | 212 | Identity: | 43/212 - (20%) |
|---|---|---|---|
| Similarity: | 77/212 - (36%) | Gaps: | 55/212 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 88 EWLKEQ------LCGGENELMVGEPDDDYILFDMPGQIELFTHLK-MGRQLVELLESWNFRTCVV 145
Fly 146 FCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLL---SSDARKQLEMYLEPDAHSLM 207
Fly 208 GELTIGT-----GFGEKYAKLTQAIGALI-----EDFSLVRFFPLDSQDEESVGDLLLQIDSI-- 260
Fly 261 ------LQYGEDADVNV 271 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2656 | NP_649699.1 | Gem1 | 2..196 | CDD:224025 | 26/117 (22%) |
| ATP_bind_1 | 7..263 | CDD:281079 | 40/202 (20%) | ||
| eIF5B | NP_001246599.1 | PRK04004 | 553..1129 | CDD:235195 | 43/212 (20%) |
| IF2_eIF5B | 557..769 | CDD:206674 | 39/195 (20%) | ||
| aeIF5B_II | 779..889 | CDD:293904 | 1/6 (17%) | ||
| IF-2 | 890..993 | CDD:288813 | |||
| IF2_aeIF5B_IV | 1016..1110 | CDD:293911 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||