DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2656 and eIF5B

DIOPT Version :9

Sequence 1:NP_649699.1 Gene:CG2656 / 40857 FlyBaseID:FBgn0037478 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001246599.1 Gene:eIF5B / 44261 FlyBaseID:FBgn0026259 Length:1144 Species:Drosophila melanogaster


Alignment Length:212 Identity:43/212 - (20%)
Similarity:77/212 - (36%) Gaps:55/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EWLKEQ------LCGGENELMVGEPDDDYILFDMPGQIELFTHLK-MGRQLVELLESWNFRTCVV 145
            |.:|||      ..|.|:.|      ...::.|.||. |.|::|: .|..|.::         .:
  Fly   600 EAIKEQTKYVKAAAGFEHRL------PGLLIIDTPGH-ESFSNLRNRGSSLCDI---------AI 648

  Fly   146 FCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLL---SSDARKQLEMYLEPDAHSLM 207
            ..:|   ::.|.:  ..|:.::.::...:.|.|..|.|:|.|   ...||:.:...|:....:..
  Fly   649 LVVD---IMHGLE--PQTIESIQLLKKKKCPFIVALNKIDRLYDWKQLARRDVRDVLKEQQSNTQ 708

  Fly   208 GELTIGT-----GFGEKYAKLTQAIGALI-----EDFSLVRFFPLDSQDEESVGDLLLQIDSI-- 260
            .|....|     .|.|      |.:.|.:     :..:.:...|..:...|.:|:||..|...  
  Fly   709 LEFQQRTKDVILQFAE------QGLNAALFYENTDPKTYISLVPTSAISGEGMGNLLFMIADFCQ 767

  Fly   261 ------LQYGEDADVNV 271
                  |.|.|:....|
  Fly   768 NMLAKRLMYSEELQATV 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2656NP_649699.1 Gem1 2..196 CDD:224025 26/117 (22%)
ATP_bind_1 7..263 CDD:281079 40/202 (20%)
eIF5BNP_001246599.1 PRK04004 553..1129 CDD:235195 43/212 (20%)
IF2_eIF5B 557..769 CDD:206674 39/195 (20%)
aeIF5B_II 779..889 CDD:293904 1/6 (17%)
IF-2 890..993 CDD:288813
IF2_aeIF5B_IV 1016..1110 CDD:293911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.