| Sequence 1: | NP_649699.1 | Gene: | CG2656 / 40857 | FlyBaseID: | FBgn0037478 | Length: | 283 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001257888.1 | Gene: | Gpn2 / 362614 | RGDID: | 1311749 | Length: | 310 | Species: | Rattus norvegicus | 
| Alignment Length: | 265 | Identity: | 102/265 - (38%) | 
|---|---|---|---|
| Similarity: | 146/265 - (55%) | Gaps: | 17/265 - (6%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     3 FAQIIVGPAGSGKSTYCSLMQQYAMDCKRNVQVVNLDPAAEHFTYNPLTDIRDLIHLDDAMEDEE 67 
  Fly    68 LHYGPNGGLIFCLEFLIENQEWLKEQLCGGENELMVGEP-DDDYILFDMPGQIELFTHLKMGRQL 131 
  Fly   132 VELLESWNFRTCVVFCLDSQFMVDGAKFISGTMAALSVMANMEQPHINVLTKVDLLSSDARK--Q 194 
  Fly   195 LEMYLEP-DAHSLMGELTIGTGFGEKYAKLTQAIGALIEDFSLVRFFPLDSQDEESVGDLLLQID 258 
  Fly   259 SILQY 263 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2656 | NP_649699.1 | Gem1 | 2..196 | CDD:224025 | 77/195 (39%) | 
| ATP_bind_1 | 7..263 | CDD:281079 | 99/259 (38%) | ||
| Gpn2 | NP_001257888.1 | Gem1 | 13..182 | CDD:224025 | 73/180 (41%) | 
| ATP_bind_1 | 14..261 | CDD:281079 | 99/259 (38%) | ||
| Gly-Pro-Asn (GPN)-loop, involved in dimer interface. /evidence=ECO:0000250|UniProtKB:Q9UYR9 | 76..78 | 1/1 (100%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D432496at33208 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||